SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g001318m|PACid:18115117 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g001318m|PACid:18115117
Domain Number 1 Region: 409-646,804-922
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.18e-42
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 2 Region: 945-1079
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000863
Family Quinohemoprotein amine dehydrogenase B chain 0.055
Further Details:      
 
Weak hits

Sequence:  orange1.1g001318m|PACid:18115117
Domain Number - Region: 336-440
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.00152
Family Nitrous oxide reductase, N-terminal domain 0.036
Further Details:      
 
Domain Number - Region: 70-123
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0271
Family cAMP-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g001318m|PACid:18115117
Sequence length 1101
Sequence
MSSLSRELVFLILQLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGFTKVDDNRYSMKIF
FEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKY
GDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLNWQHQLCKNPRPNP
DIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQPTPAPVPTPLAGW
MSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGDSDHLSKRTRPIGI
SDEINLPVNVLPVSFTGHSHSHSHSQAFSTPEDLPKTVTRTLNQGSSPMSMDFHPVQQTL
LLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSVNRVIWSPDGS
LFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQLCVITCGDDKTIKV
WDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLGSRVDYEAPG
RWCTTMAYSADGTRTYQGFRKRSLGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSID
ADGGLPASPRIRFNKDGCLLAVSTNDNGIKILATSDGIRLLRTFENLAYDASRTSENSKP
TISPISAAAAAAATSAGLADRAASMVSIPGMNGDVRSLADVKPRITEESNDKSKVWKLTE
LSEPNQCRSLRLPENLRATKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATA
SVAPQLWQPPSGIMMTNDVTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMA
TFMPPPPAATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHA
LNVLVSSGADSQLCVWSSDGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHET
QLAIFETTKLECVKQWVPRESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRI
NPSAYLPAGVSSSNVHPLVIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNG
STSSMPATPPVGGSGSDQAQR
Download sequence
Identical sequences orange1.1g001318m|PACid:18115117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]