SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g001787m|PACid:18125693 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g001787m|PACid:18125693
Domain Number 1 Region: 109-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-44
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g001787m|PACid:18125693
Sequence length 1013
Sequence
MLTETGLWERKTINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKENDFIPNY
PNLPSKLICMLHSVTLHADPETDEVYAQMTLQPVNKYEKEAILASDMGLKQNRQPTEFFC
KTLTASDTSTHGGFSVPRRAAEKIFPPLDYSMQPPAQEIVARDLHDTTWTFRHIYRGQPK
RHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPALSSSVISSDSMHIG
ILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMFETEESGV
RRYMGTITSISDLDPLRWKNSQWRNLQVGWDESTAGERPSRVSLWETEPVVTPFYICPPP
FFRPKFPKQPGMPDDESDIENAFKRAMPWLGDDFGMKDATSSIFPGLSLVQWMSMQQNNQ
FPAAQSGFFPSMVSSTGLHSNFGTDDPSKLLNFQASALAAPNLQFSKANPQNQVNQLPQS
PIAWTQQQQLQHLLQNPLNQQQQQHPQLHQQRQQQQQLLHPQQSQQQQQQQQNHHHHNQQ
PPPPPQLQPSPTPPHSQSQSQSPVPQRPQQQPQQQQQQPQQQIFLPTHVNNGVLVPNANQ
NVQQPTVYSQLQQPQLLTSNTQAPQGILSNNKNSYQLTSLPQDSQFQQQMEQSTGPLQRQ
QQQSQLQQSSLQFLQQSLAQRAQQQPQVQQLAQQSMSDQQLQSQLQQKLQQQQQQQLLSP
AGSLLQPQLLQQQLAHQQNQQLSQLPPSQNHQQQLSNNLSASVLVQPQQLPMNQPQNQNR
PLTGTRAHSNHTDGDAPSCSTSPSSNNCQISPSNFLNRNQQGPAMLMGDSVVEPSSNLVQ
ELHSKSDARIKHELPISKGPEHLKYNGSMTDQVEASSSGTSYCLDPGNIQQNFSLPTYCL
DGDTQSHPRNSLPFVANIDGMAPDTLLSRGYDSQKDLHNLLSNYGGTPRDIETELSTAAI
SSQSFAVPNIPFKPACSNEVGINEAGVLGNGLWANQTQRMRTFTKVCYAIYSL
Download sequence
Identical sequences A0A067G5F9
orange1.1g001787m|PACid:18125693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]