SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g002489m|PACid:18114285 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g002489m|PACid:18114285
Domain Number 1 Region: 364-466
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g002489m|PACid:18114285
Sequence length 916
Sequence
MKHKTHPCNPVALSFISVSVFIFNLDLTCLSCNYCYLVLQILNIRCFVFCAAILTLILCV
YRSIYEEGRFCDTFHVNASGWRCCESCGKRVHCGCITSVHAFTLLDAGGIECMTCARKNV
LVAPTPSWPPSLFYQTPFPERIKDLSVKNWTQLAGSGPVPWRQAPSLFNSSIPQPELRPR
LPYEVDLSAGIDRINASERLSVPSLEKRKLEDFSERLMNGGLKSGSRDIPENANAGWNQF
RASRSNCDMQPSSCLNKPQQSSTLKDDSSTPHFGLAVSYASPSETNSQIGVSGSHLRPVV
QPPLVKQFHGNLPNGADSLGETQVRNGRPRVDARGRSQLLPRYWPRFTDQDLQQISGDSN
SVITPLFEKMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLKVQDSKGKEWIFQFRF
WPNNNSRMYVLEGVTPCIQNMQLQAGDIVTFSRLEPEGKLVMGFRKASSASASDQDNEAN
KAGTGIPANGHAELADPSSWSKVDKSGYIATEALGAKSSISRKRKNTTLGSKSKRLKIEN
EDVIELKLTWEEAQGLLRPPPNNVPSVVVIEGYEFEEYEDAPILGKPTIFATDNVGEKIQ
WVQCEDCSKWRKVPANARLPSKWTCSGNLWDPERSVCSVAQELREEQLEDLIAPNNPASS
KKLKAAKQEPDCVEALEGLDTLANLAILGEGEGLTASSQATTKHPRHRPGCSCIVCIQPP
SGKGPKHKQTCTCNVCLTVKRRFHTLMLRREKKQSEKDAETSRKKQQQQKLPVPEKSADD
DPLSCSKTGNNSPNEKKVVSEGSDDDSSRIKSSTSPFKGQIDLNIQPEREEELSPGSDSG
SMIRLLQDATEKYLRQQRLSSSGVNTSSVDNEGLQGGVTGEKISNGITLDGSHQDTDEDH
HGSLSVKASASISATG
Download sequence
Identical sequences A0A067G846
orange1.1g002489m|PACid:18114285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]