SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g002516m|PACid:18092571 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g002516m|PACid:18092571
Domain Number 1 Region: 101-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.32e-47
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 798-878
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000491
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g002516m|PACid:18092571
Sequence length 913
Sequence
MGSVEEKIKAGGLVIRAQTTLLEEMKLLKEMQDQSGARKAINSELWHACAGPLVFLPQVG
SLVYYFPQGHSEQADKDTDEIYAQMSLQPVNSEKDVFPIPDFGLKPSKHPSEFFCKTLTA
SDTSTHGGFSVPRRAAEKLFPPLDYTMQPPTQELVVRDLHDNTWTFRHIYRGQPKRHLLT
TGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLAAA
AHAASNRSQFTIFYNPRACPSDFVIPLAKYRKSVYGTQMSVGMRFGMMFETEESGKRRYM
GTIVGISDLDPLRWPGSKWRNLQVEWDEPGCSDKQKRVSPWEIETPESLFIFPSLTSGLK
RPFHSGILATETEWGSLIKRPLACPEIAPGVMPYSSISNLCSEQLIKMMLKPQLVNNPGS
FAASSLQETSGAKGAHLEEVKTLQSTINQKPRLVPSEMNRIDNQNCSQICLNQADTVNSS
LSRINIPEKPHPPSKCEKQAPPGMNTDHLKSEPRQSIEQSSNLTSAADCSMEKPSGPLNP
QNLVNQHAFHNQNEGLLQLQSSWPMQSQLESVFQAQQINVPQSDSTAHSGSLPILDTDEW
MSHTSCNSLAGTYNRSPGPLPMFGLQEPSTMLPEVINPSLSFPGQEMWDHQLNNLRFLSP
VDPLTSFTQQDHCSLNSSGLRDLSDESNNQSGIYSCLNIDVSNGGSTMIDHSVSSAILDE
FCTLKDANFQNPPDCLMNTFSSSQDVQSQITSASLADSQAFSRQDFPDNSGGTSSSNVDF
DESSLLQNTSWQPVVPPMRTYTKVQKTGSVGRSIDVTNFKNYDELCSAIERMFGLEGLLN
DPRGTEWKLVYVDYENDVLLVGDDPWEEFVGCVRCIRILSPQEVEQMSEEGMKLLNSAAM
QGIDCTKPEGGRA
Download sequence
Identical sequences orange1.1g002516m|PACid:18092571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]