SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g002615m|PACid:18093891 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g002615m|PACid:18093891
Domain Number 1 Region: 2-341
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.7e-67
Family Acetyl-CoA synthetase-like 0.0000262
Further Details:      
 
Domain Number 2 Region: 534-895
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.75e-36
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 3 Region: 359-417
Classification Level Classification E-value
Superfamily ACP-like 0.00000121
Family Peptidyl carrier domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g002615m|PACid:18093891
Sequence length 900
Sequence
MQDLYPLHGEELLLFKTSISFIDHLQEFLSAILTACTLVVPPIIELKKNLISIIHFLQAY
SISRLTTVPSLMRVVLPALQSQHNMHVPSSLKLLVLSGEVLPLSMWDIISKLFPNISILN
LYGSTEVSGDCTYFDCKRLPSILEMSTLKSVPIGLPISNCDIVLVESDTVKPDEGEIYAG
GLCLSNGYFSESTFMPSEYVKLHNNSICNCSVSCGSQTYFRTGDFARRIQSGDLVFLGRK
DRTIKINGQRMALEEIEHTLRGHPDVVDTAVVSHKHQGELVILVAFIVLKEKKTSSEIFL
SSIKSWVSSKLPLAMIPNRFVFMDSLPMTSSGKVDYASLSASTSFTISAQHDADETKASD
LLQVIRKAFGHALMVEEVLHHDNFFTMGGNSIAAAHVAHNLGIDMRLIYNFPTPSKLEIA
LLEKKGLCNLDVSADANWKLNLEEDKEHQFHSGYSRTENHAVVSKRLKVNSTKYFKPELH
HHKDGLPWNLSSVPMSCSFSRCNKVMHEEKIRGNDLCGVNWSLEVPRNKRGFIQELWKVH
MESCVDASPLVVLKDSDIYLFVGSHSHKFICADAKRSSVLWEIKLEGRIECSAAVLADFS
QVVVGCYKGKIYFLDYLTGDIYWTFQTCGEVKCQPVVDAPRQLIWCGSHDHNLYALDFRN
YRCVYKLPCGGSIFGSPAIDEVHDVLYVASTSGRLTAISVKALPFHTLWLHELEVPAFAS
LCITSANRHVICCLVDGHVVALDSSGSIIWRCRTGGPIFAGPCTSFALPSQVLICSRNGS
IYSFEQESGNLLWEYSVGDPITASAYIDEHLQLKLESCLSIDRLVCICTSSGSIHILRVN
LDVTGKENQSKDHMVQEFAKLELQGDIFSSPVMIGGRVFVGCRDDYIYCIALETQHLEEE
Download sequence
Identical sequences A0A067DIB7
orange1.1g002615m|PACid:18093891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]