SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g002626m|PACid:18114287 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g002626m|PACid:18114287
Domain Number 1 Region: 356-440
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000458
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g002626m|PACid:18114287
Sequence length 899
Sequence
MKHKTHPCNPVALSFISVSVFIFNLDLTCLSCNYCYLVLQILNIRCFVFCAAILTLILCV
YRSIYEEGRFCDTFHVNASGWRCCESCGKRVHCGCITSVHAFTLLDAGGIECMTCARKNV
LVAPTPSWPPSLFYQTPFPERIKDLSVKNWTQLAGSGPVPWRQAPSLFNSSIPQPELRPR
LPYEVDLSAGIDRINASERLSVPSLEKRKLEDFSERLMNGGLKSGSRDIPENANAGSNCD
MQPSSCLNKPQQSSTLKDDSSTPHFGLAVSYASPSETNSQIGVSGSHLRPVVQPPLVKQF
HGNLPNGADSLGETQVRNGRPRVDARGRSQLLPRYWPRFTDQDLQQISGDSNSVITPLFE
KMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLKVQDSKGKEWIFQFRFWPNNNSRM
YVLEGVTPCIQNMQLQAGDIGNQPKSQESYEMFSFMWKDNEANKAGTGIPANGHAELADP
SSWSKVDKSGYIATEALGAKSSISRKRKNTTLGSKSKRLKIENEDVIELKLTWEEAQGLL
RPPPNNVPSVVVIEGYEFEEYEDAPILGKPTIFATDNVGEKIQWVQCEDCSKWRKVPANA
RLPSKWTCSGNLWDPERSVCSVAQELREEQLEDLIAPNNPASSKKLKAAKQEPDCVEALE
GLDTLANLAILGEGEGLTASSQATTKHPRHRPGCSCIVCIQPPSGKGPKHKQTCTCNVCL
TVKRRFHTLMLRREKKQSEKDAETSRKKQQQQKLPVPEKSADDDPLSCSKTGNNSPNEKK
VVSEGSDDDSSRIKSSTSPFKGQIDLNIQPEREEELSPGSDSGSMIRLLQDATEKYLRQQ
RLSSSGVNTSSVDNEGLQGGVTGEKISNGITLDGSHQDTDEDHHGSLSVKASASISATG
Download sequence
Identical sequences A0A067GAU5
orange1.1g002626m|PACid:18114287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]