SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g002629m|PACid:18127408 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g002629m|PACid:18127408
Domain Number 1 Region: 113-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 757-839
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000329
Family PB1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g002629m|PACid:18127408
Sequence length 898
Sequence
MRLATSGFNQQTQEGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKE
VDAHIPNYPNLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAP
NKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKF
RHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSV
LSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFR
MLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPL
TTFPMYSSPFPLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQGYG
VTPWMQPRLDASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGTAS
MIPRQMLQQSQAQNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQLHQ
LSVQPQISNVISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHTIL
GSLSQAGASHLLNSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSNVS
ELASLLPPFPGREYSSYHGSGDPQNNLLFGVSIDSSLMGQNGLPNLKNISSENESLSLPY
AASNFTNNVGTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFGRSL
DISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVG
YIKILSPLEVQQMGKGLSPVTSGPGQRLSSNNNFDDYVSRQELRSSSNGVASMGSINY
Download sequence
Identical sequences A0A067F7V4
orange1.1g002629m|PACid:18127408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]