SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g003369m|PACid:18105421 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g003369m|PACid:18105421
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-20
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g003369m|PACid:18105421
Sequence length 825
Sequence
MQPPAQELMARDLHDNIWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQ
QLLLGIRRANRQPANLSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVVP
LAKYYKAVHSNQISLGMRFRMMFETEESGTRRYMGTITGISDLDPVRWKNSQWRNLQVGW
DESTAGEKRNRVSIWEIEPVTAPFFICPPPFFRSKHPRQADDDASDLDNVFKRTMPWIGD
DFGVKDSQSLPGLSLVQWMNMQQNPSLANAMQSSYMHSLPGSILQNLNGGLSQMPQQNNL
QYTGQSLPQQVPQIDQLAKLPSTVNPLGSNILPQQPLGDISQQSRQNMITQNLPSGPVQA
QVLQPQNLVQTSNILQQQPSIQNPQLPANLPQNLQQQQQQQHIMGQNQQQNLMQTQLPDP
INQNLQMSDKQIQLHLLQKLQQQRQSLLSQQSALQQPAQLIQLQDQQRQLLDASQSFSRS
GTPTQMLEMHQVTPTSLPQSNIMSQQIANSGSLNNVQFSQPPQQPKLEQQQPGILPQMPG
HMGLPASHIINPVSTAGNSALTGAAGVGQSVITDDNPSCSTSPSTNNCQRLIQPTINSRT
HRSAGIGEEVAQSASALLNPSALETMPSNANLVKDLPHKSDVKPSVNISKTQNQGFFTPQ
TYLNGAATQTDYLDTSSSTTSVCLSQNDVHLQQNNSLSYNPQSTLRDASQDGEVPVDPRS
NIPYGANIDGPLGSMNPDPLLTKGMMGLGKDFSNNISSGAMLANYENSKDAQQELSSSIV
SQSFGVPDMAFNSIDSTINDSSFLNGGPWAPPPQFPQRMRTYTKV
Download sequence
Identical sequences A0A067F782
orange1.1g003369m|PACid:18105421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]