SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g003505m|PACid:18127411 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g003505m|PACid:18127411
Domain Number 1 Region: 30-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.01e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 674-756
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000285
Family PB1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g003505m|PACid:18127411
Sequence length 815
Sequence
MHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAPNKQPTNYFCKTLTASDTSTHGGF
SVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSA
KRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSR
FTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL
DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYSSPFPLRLKRPWPSGLP
SFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQGYGVTPWMQPRLDASIPGLQPDVYQA
MAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGTASMIPRQMLQQSQAQNALLQSFQEN
QASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQLHQLSVQPQISNVISTLPHLASSSQS
QPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHTILGSLSQAGASHLLNSNASNPIISS
SAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSNVSELASLLPPFPGREYSSYHGSGDP
QNNLLFGVSIDSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSS
CVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEG
QLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGKGLSPVTSG
PGQRLSSNNNFDDYVSRQELRSSSNGVASMGSINY
Download sequence
Identical sequences A0A067FJ09
orange1.1g003505m|PACid:18127411 orange1.1g003506m|PACid:18127412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]