SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g003592m|PACid:18097622 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g003592m|PACid:18097622
Domain Number 1 Region: 164-287
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.07e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 675-758
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000011
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g003592m|PACid:18097622
Sequence length 808
Sequence
MEFDLNHAATTEGEKIAFCNGDCGKNNSGCVCYLNSSSSSSSCSANSSSSSSLSSSIYFE
LWHACAGPLTSLPKKGNVVVYFPQGHLEQVASSSAFPPIEVPNFDLQPQIFCKVVDVQLL
ANKENDEVYTQVALLPQPELEGLNLEAKQLEDLGVDEEGGGRSPTKSTPHMFCKTLTASD
TSTHGGFSVPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTG
WSIFVSQKNLVSGDAVLFLRGKDGELRLGIRRSVQPRNGLPDSILSKQNSYPNVLSVVAN
AVSTKSMFHVFYSPRATHADFVIPYQKYVKIIMNPICIGTRFKMRFEMDDSPERRCNGVV
TGITDLDPYRWPNSKWRCLMVRWDECIGSDHQEQVSPWEIDRSVSLPPLSIQSSPRMKKL
RTGLQAPPPDYPVSARGGGVLDFEESVRSSKVLQGQENVGFVSPLYGCDTVNHPLGFEMR
APAHQSLALNGIRKDNINELVRALPTSYTGFVESNRFPKVLQGQEICPLRSLTGKVDLNL
GTWGKPNFGCNSMNMYQASKPNIYPPPSESLSNMFFPYGDMPKTVQHHTMPPYASNLQRE
NVKLNSSSIQMPAIGAEIRKANLLNEHKPVENIPTPTFKANMRSHKDGSFNGTAAGCKLF
GFSLTSETPTPSSQSPGKRSCTKVHKQGSLVGRAIDLWRLNGYNDLLSELEHLFNMEGLL
RDPAKGWRILYTDSENDVMVVGDDPWHEFCNEVSKIHIYTQEEVEKMTIGTTDDTQSCLD
QAPVIMEVSVSKSSSVSQPDSSPTVVRV
Download sequence
Identical sequences A0A067GCZ5
orange1.1g003592m|PACid:18097622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]