SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g003731m|PACid:18123277 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g003731m|PACid:18123277
Domain Number 1 Region: 101-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-48
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 675-753
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000181
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g003731m|PACid:18123277
Sequence length 799
Sequence
MIGDNKCLNSELWHACAGPLVSLPTVGTRVVYFPQGHSEQVAATTNKEVDSHIPNYPNLP
PQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKDTFVPIELGIPSKQPTNYFCKTLT
ASDTSTHGGFSVPRRAAEKVFPSLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLL
TTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAIRPPTVMPSSVLSSDSMHIGLLAA
AAHAAATNSCFTVFFNPRASPSEFVIPLTKYVKAVFHTRVSVGMRFRMLFETEESSVRRY
MGTITGISDLDPVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLR
LKRPWHPSTSSFNDNRDETASGLNWLRGGTGEQGLTTLNFQSLGMFPWMQQRVEPSFLGN
DHNQQYQAMLAAGMQSGDPVRQQFMQLQQPFQYLQQSGSQNPLQLKQQQHLLQQLNSQAE
DRAQQQQQPQQHMYHDALQIRTDELLQRQQSNLPSPSFSKANFMDSSTEISVSISPMQNM
LGSLPEGSGNLLNFSGAGPSMLRQQFPQQSLGSKYEPSQVRDFVHSMSLPSSYNGKDAAV
GTENCNTDSQNSVVFGVHIDSSGLLLPTTVSSFTTSVDPGVSSMPLGDSGFHNSMYGCMQ
DSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFE
DPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG
QRANSRGNCGRDPVGSLEY
Download sequence
Identical sequences A0A067F2A0
orange1.1g003731m|PACid:18123277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]