SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g005060m|PACid:18136941 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g005060m|PACid:18136941
Domain Number 1 Region: 142-268
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-35
Family B3 DNA binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 621-694
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000432
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g005060m|PACid:18136941
Sequence length 716
Sequence
MAVVGEEGKASGSRRMAAHHRKHMDDALPTKHKPAEAGGKNELYNELWRACAGPLVYVPR
VGDIVYYFLQGHMEQVEAYNSQDDKAELPIYNLPPKILCEVVYAQLKAEPGTDEVFAQIT
LLPRPEIDELSLEVGNSPPLPPKLNVCSFSKKLTPSDTSTHGGFSVPKRHADECLPPLDM
SKDPPLQELVAKDLHGLEWRFRHIYRGQPKRHLLTSGWSVFVTSKKLVAGDVCIFLRGGD
GELRVGVRRAMKLQNNASTSVISSLSMQHGILAGAFHAISTGTRFTVYYHPWTRPAEFLV
PFSQYMKSAEIDYSIGTRFRMVFEGEECADQRIAGTVVGTEDVDHIRWPASEWRCLKVKW
DATTDSITRPARVSPWNIEPIERTHKRPASVQHQQKRLRPNDASSPWFSSLFSNGVFQGQ
ENRVTGVKALGAAKTPLLPSLVRPPNPVWAQMQSGLENKLKFPMHDPFYMCLNRMVSLPG
GSLMSPGLSNHWPASPFAPYEVCETAAQSKNLSVPNASSENSGSQMCMALELKDENRTPL
AQPNGGSRYMLFGVNLVNSPPELPSPQMATSNELESPCSVPPTSQSSISETIQVSEPSKS
VSGILSEKQCKNCYVSRSCTKVIKFGTALGRSVDLTRFHGYDELISELDQMFDFNGSLID
GNSGFHIAYMDDEGDMMLVGDNPWQDFQCAVRRMFICPKEDIDGVIPSSPNPTPPQ
Download sequence
Identical sequences A0A067H8T0
orange1.1g005060m|PACid:18136941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]