SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g005368m|PACid:18135942 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g005368m|PACid:18135942
Domain Number 1 Region: 117-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-40
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 578-660
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000255
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g005368m|PACid:18135942
Sequence length 699
Sequence
MAYVEPNFGCSLSSQGGPGSGDLYRELWKACAGPLVEVPRNGERVYYFPQGHIEQLEAST
NQELTHQEPLFDLPSKILCRVVHIELLAEQETDEVYAQITLHPETDQTEPRSPDQCLPEP
PKQTVHSFCKILTASDTSTHGGFSVLRKHATECLPPLDMTLATPTQELAAKDLHGYEWRF
KHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGENGELRVGVRRLAHQQSSMPSSV
ISSQSMHLGVLATAAHAVKTSTLFIVYYKPRTSQFIIGLNKYLEAVHHCFSVGMRFKMRF
EGEDSPERRFTGTIVGVGDFSEQWPGSKWRSLKIQWDEPATVQRPERVSPWEIEPFVASA
PLNLAQPAVKSKRPRSIDIPASEITTNSAASAFWYQGSTQSHDITQVVGATEGQSSESQV
VRPMRQKEIDSTIINNSNDCSSRLAPEGIWPSSPHLNVSLNLFPDSTDDHRIVAAQSVLS
GYASSGRPGNTVIHEEVERGKKSEASLGCWLFGIDLKHNSNTAAPLGRKVVDPTTGTSGV
KGSARAASDFDASQNQDLKEVKRGMADVSRKETQNKQGSAASTRTRTKVQMQGIAVGRAV
DLTALKGYDDLFDELEKMFEIQGQLRPRDKWAVVFTDDEGDMMLAGDDQWPEFCKMVKKI
FIYSTEEVKNMATSSKPIASSVEGEGTAISLDSELKSET
Download sequence
Identical sequences A0A067HEU1
XP_006491295.1.29302 orange1.1g005368m|PACid:18135942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]