SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g005562m|PACid:18114292 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g005562m|PACid:18114292
Domain Number 1 Region: 139-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.11e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g005562m|PACid:18114292
Sequence length 691
Sequence
MNGGLKSGSRDIPENANAGSNCDMQPSSCLNKPQQSSTLKDDSSTPHFGLAVSYASPSET
NSQIGVSGSHLRPVVQPPLVKQFHGNLPNGADSLGETQVRNGRPRVDARGRSQLLPRYWP
RFTDQDLQQISGDSNSVITPLFEKMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLK
VQDSKGKEWIFQFRFWPNNNSRMYVLEGVTPCIQNMQLQAGDIVTFSRLEPEGKLVMGFR
KASSASASDQDNEANKAGTGIPANGHAELADPSSWSKVDKSGYIATEALGAKSSISRKRK
NTTLGSKSKRLKIENEDVIELKLTWEEAQGLLRPPPNNVPSVVVIEGYEFEEYEDAPILG
KPTIFATDNVGEKIQWVQCEDCSKWRKVPANARLPSKWTCSGNLWDPERSVCSVAQELRE
EQLEDLIAPNNPASSKKLKAAKQEPDCVEALEGLDTLANLAILGEGEGLTASSQATTKHP
RHRPGCSCIVCIQPPSGKGPKHKQTCTCNVCLTVKRRFHTLMLRREKKQSEKDAETSRKK
QQQQKLPVPEKSADDDPLSCSKTGNNSPNEKKVVSEGSDDDSSRIKSSTSPFKGQIDLNI
QPEREEELSPGSDSGSMIRLLQDATEKYLRQQRLSSSGVNTSSVDNEGLQGGVTGEKISN
GITLDGSHQDTDEDHHGSLSVKASASISATG
Download sequence
Identical sequences A0A067GKC6
orange1.1g005562m|PACid:18114292 orange1.1g005563m|PACid:18114291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]