SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g006119m|PACid:18097623 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g006119m|PACid:18097623
Domain Number 1 Region: 527-610
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000824
Family PB1 domain 0.03
Further Details:      
 
Domain Number 2 Region: 65-139
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000209
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g006119m|PACid:18097623
Sequence length 660
Sequence
MRRGVEDHLQNQLLICSAKHLQLLILVPMAGSLFLVGLPKIVSLLWTINSRDPLKSLLPR
TCMEWSGGFDIFIEFNVYYLLGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRGKDGELRL
GIRRSVQPRNGLPDSILSKQNSYPNVLSVVANAVSTKSMFHVFYSPRATHADFVIPYQKY
VKIIMNPICIGTRFKMRFEMDDSPERRCNGVVTGITDLDPYRWPNSKWRCLMVRWDECIG
SDHQEQVSPWEIDRSVSLPPLSIQSSPRMKKLRTGLQAPPPDYPVSARGGGVLDFEESVR
SSKVLQGQENVGFVSPLYGCDTVNHPLGFEMRAPAHQSLALNGIRKDNINELVRALPTSY
TGFVESNRFPKVLQGQEICPLRSLTGKVDLNLGTWGKPNFGCNSMNMYQASKPNIYPPPS
ESLSNMFFPYGDMPKTVQHHTMPPYASNLQRENVKLNSSSIQMPAIGAEIRKANLLNEHK
PVENIPTPTFKANMRSHKDGSFNGTAAGCKLFGFSLTSETPTPSSQSPGKRSCTKVHKQG
SLVGRAIDLWRLNGYNDLLSELEHLFNMEGLLRDPAKGWRILYTDSENDVMVVGDDPWHE
FCNEVSKIHIYTQEEVEKMTIGTTDDTQSCLDQAPVIMEVSVSKSSSVSQPDSSPTVVRV
Download sequence
Identical sequences A0A067G0V2
orange1.1g006119m|PACid:18097623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]