SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g006471m|PACid:18118815 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g006471m|PACid:18118815
Domain Number 1 Region: 70-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.84e-38
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 526-607
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000216
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g006471m|PACid:18118815
Sequence length 643
Sequence
MEQLEASTNQELNQRIPLFRLPSKILCRVVNIHLMAEQETDEVYAQITLLPEPSQNEPTT
PDPCPADSPRPKVHSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMNQSTPTQELVAKD
LHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELHVGVRCLARQ
QSSMPSSVISSQSMHLGVLATASHAVATQTMFVVYYKPRTSQFIISLNKYLEAVNNKFAV
GMRYKMRFEGEDSPERRFSGTVVGVEDFSPHWKDSKWRSLKVQWDEPASITRPDRVSPWE
IEPFVASATPNLVQPVLAKNKRPRLSMEVPPLDLPSAASAPWSARLAQSHNLTQLSVTAE
DKRIDNHVAWHHKHSDFSSNSNFMSRTQSDGEWLTSPRVKFSQQLFQEAIDDNKNISAWP
AHSGHSTPHPSKPNNDTLLEQVETGRKTETGTSCRLFGIELINHATSSAPSEKVPVSSLT
TEGHIISTISAAADSDGKSDIAKEFKEKKQEQVQVSPKESQSKQSCLTSNRSRTKVQMQG
VAVGRALDLTTLVGYDHLIDELEEMFDIKGQLHTRTKWEIVYTDDEGDMMLVGDDPWHEF
CNMVKRIFICSSQDVKKMSPGSKLPMFSIEGEDILLSSDSAEK
Download sequence
Identical sequences A0A067GMP5
orange1.1g006471m|PACid:18118815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]