SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g007923m|PACid:18117481 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g007923m|PACid:18117481
Domain Number 1 Region: 263-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-17
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 50-186
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000424
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g007923m|PACid:18117481
Sequence length 585
Sequence
MDNRNGFSDSNEISNNSRTSCVAAAANTESFYSSEPVNSDITALRILSKTLETIFESQDF
DYFTDAKIVLSTGREVPVHRCILSSRSGFFKNVFAGTGKQRGPKFELKELVRDYEVGFDP
LVAVLAYLYCGKVRPFPIGVCVCVDDDACSHVACRPAVDFMVEVLYVSFAFQVPELVALY
QRHLLDILDKVVADDILVVLSVAHMCGKACEKLLERCIEITVKSDIDIVTLDKTLPQHIV
KQIIDLRVELSLHRSESCGFPDKHTKRIHRALDSDDVELVRMLLKEAHTNLDDAHALHYA
VAYCDAKTTTELLDLGLADVNHRNSRGYTVLHVAAMRKEPKIIVSLLTKGARPSDLTLDG
RKALQISKRLTKAADYYIPTEEGKTTPKDRLCIEILEQAERRDPLLREASHSFAMAGDDL
RMKLLYLENRVGLAKLLFPMEAKVIMDIVHLDGTLEFALDGIKTKKMAGAQRTTVDLNEA
PFKMQEEHLNRMKALCRTVELGKRFFPRCSEVLNKIMDADDLNQLACPGNDTPEERLLKR
IRYMELQEVVSKAFNEDKEEFDRSAISSSSSSKSVVRPRGGKRTH
Download sequence
Identical sequences A0A067DV50 V4UKH6
XP_006451500.1.91645 XP_006475479.1.29302 clementine0.9_005813m|PACid:19254919 orange1.1g007923m|PACid:18117481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]