SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g008273m|PACid:18114298 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g008273m|PACid:18114298
Domain Number 1 Region: 356-458
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-20
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g008273m|PACid:18114298
Sequence length 571
Sequence
MKHKTHPCNPVALSFISVSVFIFNLDLTCLSCNYCYLVLQILNIRCFVFCAAILTLILCV
YRSIYEEGRFCDTFHVNASGWRCCESCGKRVHCGCITSVHAFTLLDAGGIECMTCARKNV
LVAPTPSWPPSLFYQTPFPERIKDLSVKNWTQLAGSGPVPWRQAPSLFNSSIPQPELRPR
LPYEVDLSAGIDRINASERLSVPSLEKRKLEDFSERLMNGGLKSGSRDIPENANAGSNCD
MQPSSCLNKPQQSSTLKDDSSTPHFGLAVSYASPSETNSQIGVSGSHLRPVVQPPLVKQF
HGNLPNGADSLGETQVRNGRPRVDARGRSQLLPRYWPRFTDQDLQQISGDSNSVITPLFE
KMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLKVQDSKGKEWIFQFRFWPNNNSRM
YVLEGVTPCIQNMQLQAGDIVTFSRLEPEGKLVMGFRKASSASASDQDNEANKAGTGIPA
NGHAELADPSSWSKVDKSGYIATEALGAKSSISRKRKNTTLGSKSKRLKIENEDVIELKL
TWEEAQGLLRPPPNNVPSVVVIEGYEFEEYE
Download sequence
Identical sequences A0A067G850
orange1.1g008273m|PACid:18114298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]