SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g008608m|PACid:18133873 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g008608m|PACid:18133873
Domain Number 1 Region: 7-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-25
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g008608m|PACid:18133873
Sequence length 560
Sequence
MLMSVFHPWLDMSRQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLV
AGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVY
YKPRTSPSEFIVPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRW
RDSKWRCLKVRWDETSTIPRPERVSLWKIEPALAPPALNSLPMPRPKRPRSNMLPSSPDS
SVLTREGSSKLNVDPSSATGFSRVLQGQEFSTLRGNFAERESNESDTAEKSVVWPPSLDD
EKIDVVSASRRYGSENWVPPGRHEPVYTDLLSGFGANADPSHGFSSPFADAVPVRKSVLD
QEGKFNLVARPWSLMPSGPSLKMPESNAKVPVQGGDVNYQVRGNVRYGGFGDYPMLNGNR
VEHSHGNWLMPPLPPSNFENSAHSRELMPKSAMVQDQEAGKSKDCKLFGIPLFSNHVMPE
PVVSHRNTMNEPAGNLDQQFRAFESDQKSDHSKSSKLADDNQVFNEHEKPSQPSQTHTKD
VRSKTQCGSTRSCTKVPLPH
Download sequence
Identical sequences A0A067E8A2
orange1.1g008608m|PACid:18133873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]