SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g010293m|PACid:18110702 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g010293m|PACid:18110702
Domain Number 1 Region: 268-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 48-193
Classification Level Classification E-value
Superfamily POZ domain 2.56e-16
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g010293m|PACid:18110702
Sequence length 513
Sequence
MVLDSIMENANEMSSSLSFASSSYLSNGSTNHPASPELCSSLDNLSLSKLSSNLEKLLLD
AEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVP
YGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQM
KELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKEL
PDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTL
DDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGA
CASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLAL
SSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSGN
LKEVDLNETPSMQAKRLQLRLQALLKTGIYIPS
Download sequence
Identical sequences A0A067E0K7
orange1.1g010293m|PACid:18110702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]