SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g010590m|PACid:18099191 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g010590m|PACid:18099191
Domain Number 1 Region: 278-362
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-19
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 9-163
Classification Level Classification E-value
Superfamily POZ domain 5.18e-19
Family BTB/POZ domain 0.023
Further Details:      
 
Weak hits

Sequence:  orange1.1g010590m|PACid:18099191
Domain Number - Region: 149-277
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 0.0615
Family Lipovitellin-phosvitin complex, superhelical domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g010590m|PACid:18099191
Sequence length 506
Sequence
MTLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPP
SGLDPATASRINQGPPSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPN
CGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIAS
RKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHH
HHDLSAAAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV
VKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDIL
RTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPP
MSCCSEEVHNNSSSGSATINNNSLNLDSSRLVYLNLGAGTGNSAHHHHHQMGSSRMDGDD
DSSHQSQREAVNRHDPSIYHHHSQEF
Download sequence
Identical sequences A0A067E4Y0 A0A2H5PQW7 V4S6N1
orange1.1g010590m|PACid:18099191 XP_006421265.1.91645 clementine0.9_007993m|PACid:19280149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]