SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g019055m|PACid:18123642 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g019055m|PACid:18123642
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000353
Family B3 DNA binding domain 0.0066
Further Details:      
 
Weak hits

Sequence:  orange1.1g019055m|PACid:18123642
Domain Number - Region: 279-336
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g019055m|PACid:18123642
Sequence length 346
Sequence
MRFCKFNMPKIDTVFIVENESGEEYKINYISQRTALSGGWKAFSDANQLYEGDVLVFHLV
EPTRFKAYIVRANGFGNVNADAKPLNSVPMDDELEVAPKDHSEKRVKKNKRAKRVKPPPG
FHRDNNQSNSLMLLETNNGHVEDQFNNDTEDLGPNKVLPHSESSNFKEMKSIDDFTILVD
GLAIDHELSDQHRSKYYDLCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLS
TSRADYEIWDKTLKGFELLGMNVGFLRARLNRLMSLAFESEESEVSKRLREVSAEQARAE
EEMRSLELKLLRLKETMGRLDSELESLKVKAEKHELKFQEEANAPW
Download sequence
Identical sequences A0A067DHX0
orange1.1g019055m|PACid:18123642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]