SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g021378m|PACid:18098223 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g021378m|PACid:18098223
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-21
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 198-295
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000051
Family B3 DNA binding domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g021378m|PACid:18098223
Sequence length 313
Sequence
MSSSAAETSSMFYSMILPSTIHNKMLRIPLKFVGQFGDELSSIAKLAVPDGRVWQVGLTK
FGRKIWFDQGWQNFVESQSISAGYFLLFKYEKNSIFRVLIFDMTACEIDYPYEDDMACEM
CVEISEEQFKHEAELLSRKRKMEDGLERDEPNAEPDLLVSLRKSGIYITEKYKELYSTEE
LERAVYIARAFKATNPKPNPLFMIIWKANDKPCREVYAPARFAYQYVDEDSKSVEVQAPS
GRKWSLGIHWRATGGFFLAKGWAGVSDYVHLTEGDICIFELVRHRDVVFKLHVFHQCSKI
TSWREKFSLVSII
Download sequence
Identical sequences A0A067DEF9
orange1.1g021378m|PACid:18098223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]