SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g021945m|PACid:18094186 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g021945m|PACid:18094186
Domain Number 1 Region: 162-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-28
Family B3 DNA binding domain 0.0000211
Further Details:      
 
Domain Number 2 Region: 31-89
Classification Level Classification E-value
Superfamily DNA-binding domain 2.22e-16
Family GCC-box binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g021945m|PACid:18094186
Sequence length 305
Sequence
MASNSSSVDLDHDHNLSENGIDAESKKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTF
IEEEEAARVYDTAALRFRGQNAITNFRTSLETDDEDDYMEKIFLSSHSKAEIVDMLRKHT
YKHELEQSKQNYACVGISCYNNSSGFSDLFGSNCFQETPVEFLFEKVLTPSDVGKLNRMV
IPKQQAEKHFALSSEIASKGLLLNFEDSTQKVWRLRYCYWSSSQSYVLTKGWSRFVKEKG
VKAGDTVSFWRSNVGSNSKLFIDCKLQQNGNGSGFEEMQSQVPNIGVVRLFGVNILEDPN
NLCCR
Download sequence
Identical sequences A0A067F6V7
XP_006482296.1.29302 orange1.1g021945m|PACid:18094186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]