SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g022922m|PACid:18116734 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g022922m|PACid:18116734
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.22e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 146-223
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.22e-22
Family Middle domain of MutM-like DNA repair proteins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g022922m|PACid:18116734
Sequence length 290
Sequence
MPELPEVEAARRAIEEHCIGKKIVKSIIADDNKVIDGVSASDFEASVLGKAILSAHRKGK
NLWLRLDSPPFPSFQFGMTGAIYIKGVAVTQYKRSAVKDTDEWPSKYSKFFVELDDGLEL
SFTDKRRFAKVRLLNDPTSVPPISELGPDALLEPMTVDEFTDSLSKKKITIKALLLDQSY
ISGIGNWVADEVLYQAKIHPLQTAVSLSKESCATLLKCIKEVREALGVSLQFYKCYFAKP
YVHKKHRENKICRLFKVRLKLMLTAAAFLLNGYFIFDGAKSLEKLMVRYL
Download sequence
Identical sequences A0A067DRM4
orange1.1g022922m|PACid:18116734 orange1.1g022931m|PACid:18116735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]