SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g023721m|PACid:18125045 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g023721m|PACid:18125045
Domain Number 1 Region: 173-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-20
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000173
Family B3 DNA binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g023721m|PACid:18125045
Sequence length 278
Sequence
MKAIPPAFAKHLNVTVPKHVIIRDYAGRQWRGKMEEVEGVIVIKDCWERFACVHSLELGD
FLVFKYNGSSLFDVKIYGINGCLKEGTNTTHHKKETPIADMNAIPVKKEIGREAEQTSIM
DDPSCNQDDLEIMLISSGKRGGSSVASRVKTRLRDEKDTGEDRAFKAARLVVPKNPHFVS
VFSQYSRYAVNVSVRVVRSHGIKLEPEMMLRDQNGRKWPVKISFRTNGRIVITGGWSDFW
REQKLEAGDKCVFEFVLTRGNMSKEMKVQVVRKMKTCL
Download sequence
Identical sequences A0A067GIB5
orange1.1g023721m|PACid:18125045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]