SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g041022m|PACid:18097849 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g041022m|PACid:18097849
Domain Number 1 Region: 89-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000549
Family B3 DNA binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g041022m|PACid:18097849
Sequence length 260
Sequence
MSALQDFKKRKINKNWTHLQILSEIALLSDADADADGVTSKEERNSIEKKLALKKGKKRV
DFGPNPPPVLPTNFLNKIRHMHGKYIVRVIQKPLYKSDISKPECRFSIPVKQVQQEFLTK
QEKILLDTCDSHKKKASRIEATLIDPSLTEKKISLRKWETKKKHHIYGSGSSYSTSSYVL
MNKWCNIVEENQLKKGDVVQVWAFRAAAAASASTSSSRLCFALVVVKRSPSDDQQEEEED
KESDHSDDKVLSRGIRFPLF
Download sequence
Identical sequences A0A067DXX5
orange1.1g041022m|PACid:18097849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]