SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g043499m|PACid:18096053 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g043499m|PACid:18096053
Domain Number 1 Region: 69-167
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-25
Family B3 DNA binding domain 0.00093
Further Details:      
 
Domain Number 2 Region: 296-391
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-18
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) orange1.1g043499m|PACid:18096053
Sequence length 396
Sequence
MPEDMHQQLDNFRMLRRLIKIFNEPDPNNRWKLKGASTIKQKFLIQKGLYTTVANNNVKQ
MAGGNRRAETSHFFKVILPSTVQEKKLRIPRKFVKRFGDELSAVATLNVPNGRVWQVGLR
KDGRKIWLQDGWDNFAEYHSIAVGYFLVFKYAKNSTFDVLVFDMTACEIDYPYDYEETES
EEGDEMETENSVEILSFTKMNTPPVQENQVKPGSKPEKKKIGGIKLETATNSREKKRCPT
HGNEHGKLKKAAYHEVETDSSDGDQVFEEMGIFMSEGHRYLSVEERQSLVTAVRLFKPQN
PSFVDILRSKKRYSYMYVPSKFSKKHLIRGTRSIKLQDSDGKEWPAQLTWSSGCGIKGGW
PAFSKYKNLKQGHVCVFELIKAKDILLKVSIHASSE
Download sequence
Identical sequences orange1.1g043499m|PACid:18096053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]