SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g045501m|PACid:18095009 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g045501m|PACid:18095009
Domain Number 1 Region: 218-320
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000041
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 13-84,140-169
Classification Level Classification E-value
Superfamily POZ domain 0.00000000105
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g045501m|PACid:18095009
Sequence length 381
Sequence
MQSTNPKETWLEAEIVVEGKSVAVNRSVLSELSQFFRRLFNLRNDGSVSEGKPKYLLTDL
VPHGKVGYEAFNDILHRLYTGKLKAPPPEVSACVDDACSHDACPPAINYAIELMYASAAF
QMKELVFLLQLWLRSMVEKALVENVIPILVAALHCQLNQLRSVCIQRIAKSNLDNVCLEK
ELPDEVSSEIKSLRVKSNQESEANTKEVDPLREKTVRRIHKALDTDDFELLTLLLDVSNV
TLDDAYALHYAAAYCNPKVFKEVLNMDLAGLNLKDARGRTVLHVAARRNEPEVMVTLLSK
GACASETTSDWQTAVAICRRVTRRKDYLEATKQGQETNKDQLCIDVLEREMRRHSMSENL
AMSSEVMDDDFQRKLNYLEKK
Download sequence
Identical sequences A0A067DKY4
orange1.1g045501m|PACid:18095009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]