SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g046253m|PACid:18116588 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g046253m|PACid:18116588
Domain Number 1 Region: 125-233
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-16
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) orange1.1g046253m|PACid:18116588
Sequence length 241
Sequence
MNQNSMANGNNYPEELKKQGAAALALTCIKNRRLDKKAKANLHKYLKTTYLGKSISVQVN
NNAAEINTSSSSPSSTAEAANLNLVEDNGAHGDGYVDGDDDYKPPDIPPVRNLNGVIGNC
SKPLEKKLTNTDLKVNQCRLSMNRGKVLELLVPLLNEEEYRVLKEGIPVTVYDLDGNAFP
MSFKVWSESKYYVLTSGWTKFHQNKGLADKHVVTLWMFRHAETQKLCFVISWREVIAKKI
K
Download sequence
Identical sequences A0A067FGG4 V4TV95
XP_006451248.1.91645 orange1.1g046253m|PACid:18116588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]