SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for orange1.1g048346m|PACid:18104668 from Citrus sinensis v154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  orange1.1g048346m|PACid:18104668
Domain Number 1 Region: 187-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000184
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) orange1.1g048346m|PACid:18104668
Sequence length 311
Sequence
LVISSVEVLQELVIRVSILLGFLINEESKKPIRISFSPVLDEDMDFKNVKKIDTAAAAFG
NESSSRNSDQRTPLPRVFDKQREKALKKPVTNSILDDLYSKQKSGFVTYSRNKLLGDGDD
EEWAGEFMRRKKKSKRDNHGEQLGTSKSNYKKLKIGRQLIVLKERLDLPTEFRARIEQMN
GSKIYLVIQKGLFYSDISDTHARLSIPVNQVVSTEFLTGDEKRGIEGCKINVKLIEPSLQ
VSELRFTKWKMPKGGGKYSYNYALISGWKNVKNKNRLQEGDTVQVWSFRNLEEKLCLALV
LVRRASELSCC
Download sequence
Identical sequences A0A067E1J7
orange1.1g048346m|PACid:18104668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]