SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427726478|ref|YP_007053162.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427726478|ref|YP_007053162.1|
Domain Number 1 Region: 36-155
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 2.96e-27
Family ParB-like nuclease domain 0.00048
Further Details:      
 
Domain Number 2 Region: 118-150,184-263
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 2.09e-20
Family KorB DNA-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427726478|ref|YP_007053162.1|
Sequence length 316
Comment transcriptional regulator [Nostoc sp. PCC 7524]
Sequence
MSKKEQPYTSHLKGVAALLGESFNETESPANSPNTVAISLIKLPPSQPRRYFDPQKLEEL
SRSIQKLGILEPLLVRPCESGEYELVAGERRLRASQMAGLTEVPVIVREMDDITTYQVRL
VENLQREDLNPLEETEGILELLAIQMQITQQEVSSHLNRMRNVCDRNSELRHNVMSQPET
QIIEELFASLGRMSWESFVKNRLPLLNLPPDVLEVLRSGQLEYTKARAIARVKNEDTRKQ
LLEDAIAYNLSLSEIKRKIKEIEQQTASEPPSIKDLADDTFRRLKKSQVWDDPKKKAKVE
KLLTQLKALIEDDNPK
Download sequence
Identical sequences K9R2U3
gi|427726478|ref|YP_007053162.1|NC_019677 gi|427726478|ref|YP_007053162.1| WP_015116193.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]