SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427728488|ref|YP_007074725.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728488|ref|YP_007074725.1|
Domain Number 1 Region: 5832-6117
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 8.24e-32
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.011
Further Details:      
 
Domain Number 2 Region: 6998-7149
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000212
Family Serralysin-like metalloprotease, C-terminal domain 0.00079
Further Details:      
 
Domain Number 3 Region: 6675-6782
Classification Level Classification E-value
Superfamily PKD domain 0.0000000798
Family PKD domain 0.0039
Further Details:      
 
Domain Number 4 Region: 6381-6497
Classification Level Classification E-value
Superfamily PKD domain 0.0000000994
Family PKD domain 0.0068
Further Details:      
 
Weak hits

Sequence:  gi|427728488|ref|YP_007074725.1|
Domain Number - Region: 6311-6410
Classification Level Classification E-value
Superfamily PKD domain 0.00114
Family PKD domain 0.009
Further Details:      
 
Domain Number - Region: 6792-6875
Classification Level Classification E-value
Superfamily PKD domain 0.00131
Family PKD domain 0.0062
Further Details:      
 
Domain Number - Region: 6512-6595
Classification Level Classification E-value
Superfamily PKD domain 0.0161
Family PKD domain 0.004
Further Details:      
 
Domain Number - Region: 7173-7202
Classification Level Classification E-value
Superfamily PKD domain 0.0726
Family PKD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427728488|ref|YP_007074725.1|
Sequence length 7206
Comment 3-carboxy-cis,cis-muconate lactonizing enzyme [Nostoc sp. PCC 7524]
Sequence
MYFTEDNLIQPQNLDVNQSEILNLKSGLEITNLDALVNSNTLLPTSYPINSELINFINLN
TSPVNDIFPVSIDDRNLNSSIENIKSTIDTLTGQYSHGSLVLPEELIFIDSNVEDYQSLI
REIDPNTEIIILNSEQDGIHQITQALTQHQAISAVHIVSHGGIGSLQLGGSVLHLETLSN
YSSDFQQWANFLTPDADILLYGCHVAADDQGLAFIQTLSTLTDADVAASNNLTGNASVGG
DWDLEVKTGTIEARTIFPNSAIANYNGILATLSGLVSGTKSFNEDLTINGNLTLSGDVII
DISGSGTNQVNFLDSFSIQGDGQGERDSLTIKAGNGTVTIGGDIGGGGFEHLTIEAGTIK
ILDNATISTRQINGSDFLNDSSTGNSGFIRLNAPKITVGNGAQLLAHVENGSSFTDGDIK
LTSEDTGTRIGSFTIFDFQNREVDISLDGATIKAANVILTADAKDNDPFSGVPEQVQRMI
IDPVVKSSIYQLQNLILPASVQVRGAESKITLNNAVITASGKVDVISTALVDGSLQAISV
VNPINPLSRFAVAYGQATGKANALIQGNTNIQAGTDVNIKSNTTTTARVDARVFGNILQR
IQPANANELGLSVAIANTKTESKAELETGSAITAGGNVNVNAQGTVTSQARAFTAIYLSG
LTGTGIGLNFDDTDINANVNGRITAGGSSIGTEIDLSKVDSTNNTIELPNSDNPVNGEQI
VYSNGGNTSIGGLEHGKSYTVLLLDDNSIKLTNGSSIDIDNSTVNQGAEHGFNLRTGFQF
NPETAVNLDNDTITINNHGLRTGQLVAYYGDPQGEEIDISTTQGYYFVIVEDANTVKLAL
TPEDVANGLALDLRSQGTGSNHFLTFIQERRNEISFDSDTAVNLNNDTITIANHQFKTGQ
PVIYTKDPQGQEIDALLNLGDYFVIVEDANTIKLASTQSNALQGVALDLGTKGAGSNHIL
TSLESLISFDPSDSKVVNNQNNTIKIPNHGFQTGDTVVYRTDQSIVTQQTIPINLSFDPN
TSVDLTNDTITIVGHGLTTGDELTYQINYLGNPGTAIDGLEANQKYYAIVVDDDTIKLAT
SATDATDGIAINLETGAAGILHSLRSFATVTVGDEAIFGLQDGDDYYVVVIDENTIQLTE
SEIEAFLAQPIDIDASVATGTGHKLLRPEENTGIGVNANLTAQNIANSKGVAGSYPKLRD
FVGTPLAFAGVIPQLLKPGTSKEILRGDTGSPFGQMTGQNQFAAAVGFSFNLFEHDVIAR
VGADGVLKSGTDVNINASTTQRIQTLVDTETGKSETPGLGGQTGQGVAIAASTVIGLYNN
RVEAIVDNRLDGNGNIIQAATIDARRKVKVTSELIYPFLLDFEQEFDFSQDPGNSTGNLA
VLLGAFALDGKLGLTNRIFNTFITSKNRGKTNEAKGNLAFALSFAFTQFKNESQAIIRSG
AQINQDSNYQTAIQSVAVNATTDIITLDAGGVIHIDLAADVLARAVVKGSFDEAFTFFGN
RAKNGVGGTAIIQKMDNTTIAKIETKAAVHTSSLGDGLEVKAKENIISVTLGQAGGDAQF
VGFTGTGVGIIQNSETIAQIESGVKITGGSLSVIAESEATRVNVVGSVQLTESIGIGASF
AFNDITRKTKAIIGKEQTDTDTTPGDKGTLIDVTGNIDVKATTSGNIWAFSLAGAIAVKL
PTDIDNPNPFGIGVSGSSSVNNIHETTQAYINDTGNITTKTGDLKLESENDTLFVAASGG
ATILAGQNISGGLFGAFSLNEIDHTTQSFITGAVVEAKQVTVKAKENSIIHAVAVGLSGG
FAKQVLPAVQVSIPGSYSRNVVRNQTEAFLKNAAVSTTGNLIVTADNSSDTYGIGGVAGF
GTASISATLGFSAAENNIDNKIHAYIDNSTISKSGDVELSATSTAKILAVTVGGTAAGNP
GSIISFNSIALAGAGAGSGNTINNSIEAAIKNTANISGNSVTLIAEDKTEITAGAGTAAI
ALVLGSITNSGIVSVGASAAVNDIRNNVRADIDNSTVSTSGDVKLSATSTAKILAVTVGG
TAAVNTGSLNSGVLAGAGAGSSNTINNSIEVAIKNTANVNSNAVTLTAEDKTEITSGAGV
VTFGFSLETLNSGIVSVGASAAVNDIRNNVRADIDNSTVSTSDDVKLSATSTAKILAVTV
GGTAAVNTGSLNSGVLAGAGAGSSNTINNTIEAAIKNSANVSGNAVTLTAEDKTEITSGA
GTAAIAVVLGSITNSGIVSVGASAAVNDIRNNVRADINNSTVSTSGDVKLSATSTAKILA
VTVGGTAAVNTGSLNSGVLAGAGAGSSNTINNSIEVAIKNTADVSGNAVTLIAEDKTEIT
SGAGTAAIALVLGSVGLGNSGVVSVGASATVNDIRNNVKADIDNSTVSTSGDVKLSATST
AKILAVTVGGTAAVNTGSLNFGVLGGAGAGSSNTINNSIEAAIKNTADVSGNAVTLTAED
KTEITSGAGTAAIALVLGSLGFGNSGVVSVGASAAVNDIRNNVRADIDNSTVSTSDDVKL
SATSTAKILAVTVGGTAAVNTGSLNSGVLAGAGAGSSNTINNSIEAAIKNTANVNGNAVT
LIAEDKTEITSGAGTAAIAVVLGSLGNSGVVSVGASAAVNDIRNNVRADIDNSTVSTSGD
VKLGATSTAKILAVTVGGTAGVNTGVINSGVLAGAGAGSGNTINNSVEAAIKNTANVNGN
TVTLIAEDKTEITAGAGTAAIAVVLGSLGNSGVVSVGASAAVNDIRNNVRADIDNSTVST
SGDVKLGATSTAKILAVTVSGTAAVNTGSITPFNSIALAGASAGSGNTTNNFIEAAIKNS
ANVSGNAVTLIAEDKTEITSGAGTAAIALVLGSVGNSGIVSVGASAAVNDISNDVSTYID
NSTVSTSDDVNLSATSTAKILAVTVGGTAAVNAGSLNSGVLAGAGAGSSNTINNTIEAAI
KNSANVSGNAVTLVAEDKTEITAGAGSLAIAAIFGTFNSGAASVGISIVDNDISNAVKAY
IDNSTVSTTSNIDLTANSTATIDAYAAAGAIAITQSVASSGSAAGTGTTSTNTIGNTIEA
FISNNSIVTTTSGGDINLTAADHAEIAANTVGGSLSISVGGAFAGAIAIGVALAQNTTSN
TVRTYIDSSDVTANGSINLTASSTAKIDALTVAASVSAGISQSGFSFSGAGADAKNTTNN
TIRAVISNGSTVTATNSVTLEAKDDIDIKADVGSGGLAGAVIGASIGVSLANNSINNNVQ
AYVDNATVTSENKNIEIDASSTSKIDALTVATSVAVAIGGAGAGAVSDIELNTVVKAYVT
NDAELNANKDVKVSAINNIVKNKAETIGVGAGLTFAAVGVSKAKSDVGGEVEAYINNASV
TATTGDLNVHAKFITESGVVAKSTAAAGGIGLVFVTDTEAKVTINPTIKAYVGNNAEILS
GNNITIASESQIDTDVSVTGVTASVGIVSVGTTKADAVITPVVETSIRRGSNVKADGGIT
LQSKHNFGMTQPLSSMGASAKATAPITFGVGGAGTGADAKATSNADVDTYVEDSVTLNAG
AAIAISSLSHNNAKADANGLTIGLLAGVGTSVAEATASGQTATSMNGSITGASNLDIFTD
ARNIADADASASGGGLIFASDGEKGTEVNATIDADTSTSVGDNAKITGITGDITIQSLST
TDVNAKGSGSSGGVIRVGGIETQANLINRNHASIGEDVEITAGNNFQLLSKSSNNAETQS
IAGSGGVVDISRAVTTVSTDDQTTTKVGDDSKITAVNSLQVESQRNTTANSKSEADTKGL
GTNARTRTSMTLDGLTKTTVDGATLSANQVKILARVTNIEADAVSTSKARALGAEIASDA
TLTTTSTAQVDIAAQAKIKGTNQVKISARHDELKTNSKTSATTEGLGADTNSTATTTQTT
TTNVNTGTGSEIATRSLLVEANTPLTISFAATPEQNGAVIETGEATGNRTLSLNRAIDFN
SKIVMLGAPSPTLEIDANGNVVRQVNVNVQQTPTEIVVDDITNTNTLAGTIIFSMQESVY
DTTTTPVTITDVAVIRGNATVEFITGFERVDIINRSTKHLKINDIDVLNTSGQLNSNITV
NVRNKTGFNYTTTTNPGNTAISITNTSNADIRLNGFIDNPFGSTQILNNGGNIITSDPTA
KIETTALTLQTDNGSIGTASNRIQTQSSALSAIARNNIFINEFADDLTITQVTASNGNVD
LQAQGSILDGNDTATADITAQQIKLNALNGSIGSHANILEVNATATTAGLTALAQQNIVI
SDIDGGLSINDVTSIAGNVHLTLPDLASQGQDLVLGNGSKILANQGTVNLLVGDNIALAA
GSTVTAGSTVTITGDWTNADLEGTIIELAGEIKASSVLITGEVDGDVITLRNVNPGVTTT
IETGGGDDIIYIGSQATPQANADGILDNIRGQVIISGGTGTDRIELDESADSKINTGTIT
NNRVTGFGMSLGIQYADIEAMQISLGKNANTVNIQSTQDNTATLVNIGAGTNTINVGNTN
NQVNEIDGLLEIRGGTGTDTLNINDTGDTTTNAGILDSKRITGLGMGATDQTASNLERGI
VYSGLERIQINLGNGNDQFTVNGIDTETTINTGAGDDSITVGDELPRIAARLLVQGGLGV
DTLLVNSNIASDLTLNRGVITGADVPGRIEFEQITALTITQSDSNDQFTLLDTTTPVTLN
TGGGSDQITVVNTTAAVNLNLGDGDDQVTVLNANAVLAINGEDSGVDRLIIDRSSQTAAA
IGGLLRDDTQADSGVIENLTSSDITFSAIEQVEMKLGTGNDDLTIDTTLANTIVTVTGGD
GDDAITVRSIGRWVGLLPIDNFYNGDDTITVSSIGRPETNIFGELGVDTVTVIIDGVPTD
NQFTNLNLDVETLVVDNSGNNSQPLDWTLKNGEILEAQLAPGTLPISVINTQGAELTRII
GGTQADTLNVVSETTNNIEGFIDGDRVELRSGLTVLEPVSFTNNFQNYDSVINFDNLANS
ATTYLQAGFQLASSGAIMLDNSISPAAKAGSSNDTFTLTSATGAGFAIYSISLAATTSET
ESITFTGTTMNGGTAIFTAVVGNTGFQTFDVPTSFGVLKSLSWQPGTTLVDNIVAIELFA
NTTPTTIPTAIPTLNLTGNIVFDTNNLQIRVNGSVISNSSLSTSVINGNIAQFRFAGDIN
FGNNSSVTGTGSRGLSLLAGNDVNVGTDVTFNFSANGRTPGIGGGAGGGAGSGGAGSNGG
AGGNGANGGTGGAGTGGTVTIFGSYGRNGGTGGAGNAGSSSTIGGRGNNGGNGMSGINSL
NSGGGGGVGGNGGVGGNGGVRGNGGAGGGGGRPGDWASGENGSNGGNGGQGGNGNNGGNG
NPGGDGSQGQNTGNSLTISGGGGGGAGAGGGGGGGGGGGGGGGGGGGGGGGGTGSYTVLV
FPVREGSGSGGNGGRGGNGGQGGKGANGTPGGNGGSGGGAFEIIAQGQVNTSFSTFSAQG
GDGQNPGSADTSSRAPGTKDARLNEGRTNGGRGNGLAIRGGDGGNGGFGGAGGAGGAGGF
GGAGGRGAGGAGGTVKLYGTTVTAGSATVNTSGGSGSQTGGNGRLIIGSNTYAGTLPGTR
TGANTSLFTGQRADNPFLSNSFTTNQQTTPFIAGLAGGANTYGLLEGIDGRTLGIDTSNN
PDALVAVYRLDVGPSGFNQDYGSFNINGTKTADFDMLLFVNLTDSVLTNPTLGILPTTLT
SSFAQSLVTDGFRNNSTFGGTDVAQVLTALNPGAVWATLIPGDAVKVNATITGPIISINN
TTLIDGQVAYIRAARPDLNVTPNITGLQSIVLSPDSKHIYGVSPTQNALVVVNTDGLTQR
QLFKDNLEGVDGLAGATDVVMSSDGNHVYVASPADQSIAIFQRNSITGNLNFLTTVGTST
RQAVFESIALSPNGNSLYAAGNNGIVRYNRNTVTGALSQSTLVVNPDNIGNFSNIKISND
NTLIYAVSSSSDTLVVFNTSDLSVIQKITGAANGLDGAKGLAISPDNRYIYITGQNGNSL
SVFQRDSSSPTLTHVQTLQNGVNGIRGLLGASDVTVTPDGKYILVSGTDSNAIAVFYQNT
SNNKLQFVQLLRHNVGGVIGLQTPTTIVTSGSQTYISSLGTTGNRGGLAIFDTNTLLPEP
VTLLTTFDNIEALAVSTASGEDIITLRQAPSPEVVTTTINTGDGDDIVTLQALSSTTVVN
LGAGNDTAQLRANTPRTNLIVRGETGDDIINIERVGEFSRTEVFGGDNRDTVRVSGANLP
TSATTIAHGDNPNGVPQNQGDILIFDPQNPNPNTPNYTPAPPTPGAGNINVTNRGVLQYD
TFEGNVIVIAAPIINFLNQPYQIAEGQSVTLRVNVTPLGLGNSLSEPVAWDINGDGSFGE
ADGATLTLSWAQLVDLGLGDDGTYQIGVRATNSDGFSSNAFTTLTIINTPPSIQVSGANE
VAVGTPYTVNFSATDPGNDRVFEWRIDWGDGTPIEIFGSNTISATHIYTNPGKAQIIVGA
VDEDSAPNATFAAPKTVSVIVSANQVNAGGPYTIAEGEALTLNAIAVGTPTAYSWDINGD
GIFGDATDENPTLSWTQLQQLAANPIQNNGTYNVRVRVNYGTDQQATSNAVNLRVMNTAP
TANLVNSGAVNEGSTTTVSFIDQFDPSLSDTTVGFLYSYDFNNDGQFEIINSRSSSVVVP
AQFLSDSGIKTIRGVIQDQDGDTTELSTEVTVLEVSPTLIISGADSAVEGAPYILNLSAT
DPGNDTVSQWIVDWNDGTVETFAGATQSLTHRFTDNGTRVILVTAIDEDGTYTATKTVTV
SNAAPQLQNLSATTALEGGTSRLTGRIVDPGIQDSFVLVVDWGDGSSETFNLAAGTSDFD
LSHQYGDNQDYVITATVTDKDGASHTATTIAKINNAAPSIAALVLANTTIPENGLVVVSG
RITDAGIGDTHTVVIDWGDGFTSAATVDTNTRTFTASRRYADDNPTGTAIDDYTITATVT
DDDGDSGTASTIVTVTNVAPVITAFQRTETKLNRSNLVSITGEFNDVGLLDTHAVTIDWG
NGTTSNAVVDATTGAFTATYEYTVISGDGSRSALNGTSGNDRIFGGVGAKTLTGGAGSDE
FIYTDLRESSHRITDFEVGKDKINLSQLLDSLVIGGYQGTDAIADGYVRLVQGPTANSTI
IQIDRDGSQGTAIFRSFLMINNVALEAMNNPNNFIYNDVEHYIVTVTVTDDDGGEDTNTT
TISKRI
Download sequence
Identical sequences K9QNY4
WP_015137584.1.5551 gi|427728488|ref|YP_007074725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]