SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427728527|ref|YP_007074764.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728527|ref|YP_007074764.1|
Domain Number 1 Region: 419-609
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.67e-26
Family Pancreatic lipase, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 8745-9023
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 6.54e-17
Family Galactose oxidase, central domain 0.034
Further Details:      
 
Domain Number 3 Region: 10456-10543
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000981
Family PKD domain 0.0019
Further Details:      
 
Domain Number 4 Region: 10542-10629
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000034
Family PKD domain 0.0022
Further Details:      
 
Domain Number 5 Region: 10720-10805
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000209
Family PKD domain 0.0031
Further Details:      
 
Domain Number 6 Region: 10803-10890
Classification Level Classification E-value
Superfamily PKD domain 0.000000000012
Family PKD domain 0.0023
Further Details:      
 
Domain Number 7 Region: 9807-10059
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000000549
Family Galactose oxidase, central domain 0.015
Further Details:      
 
Domain Number 8 Region: 9170-9312
Classification Level Classification E-value
Superfamily YWTD domain 0.00000955
Family YWTD domain 0.049
Further Details:      
 
Weak hits

Sequence:  gi|427728527|ref|YP_007074764.1|
Domain Number - Region: 150-277
Classification Level Classification E-value
Superfamily beta-Roll 0.000173
Family Serralysin-like metalloprotease, C-terminal domain 0.003
Further Details:      
 
Domain Number - Region: 10236-10429
Classification Level Classification E-value
Superfamily beta-Roll 0.0235
Family Serralysin-like metalloprotease, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427728527|ref|YP_007074764.1|
Sequence length 11414
Comment PDK repeat-containing protein [Nostoc sp. PCC 7524]
Sequence
MENFSNLNAQNFSVLDGLETSPLALDGLETSPLASANSPLGQNTEFTLVLDEFVSVYPNR
LDLSLTRGVFPVDYLSVALPESQLTEITGIDALVGGDWLVGSIDPLLGRIDTLVGTDIDT
LVGTDFESLSVLSKQALDNYGGILLLGSPSTNDDTFTFQQSDWGTTLEINGSSGFDTLSF
ANLTTALSFSISEFSSGVLEIVVTDSTNSANIKTTSIEKIIGSTGNDIFTFNNIGNSNNL
FTVGDGVLEIDGDAGADTVNFARNLYLNGDSLSLSAETIIVPSTTKIATTGDVTLSAIAT
SNINQTSDLKPVELTANITVDGTIEAGKVKLEARIHNNLTFNASNTSFQVNSTSEATAII
GSTATIKADNLEVIAETNTDFNVQLTDATVESVSLGGNSQTRSNANFALLQEDNLGDASV
KFYLWDADDANEFNPTNPTYVVTHGWQSDIKSSANYDQLFQSIQDKEGGNVNIIFVDWSD
LAGNLDYPTAADDTLRVGNALGSFLANNLTGLNPTTITLIGSSLGAHVSGNAGAKYQELT
GNSLNLIIGLDPAGPEFEGALGRGEAERLNSSDATRVVAIHTSDILGYNGTLGQLDLYVN
PDSILQPEASSFIENHYYGLILLAQLLAGESFEQSGSSFDDGSLDYADIAGTSLSGSIDV
TTNIKPISITTYAGIDGGATINAGVISDPNSISVIATDNTNLQTKITTDTNISNVIGFDA
VQSDITLARDTKAYIGDSLVATTVVGKDGVSATGGVEVLATATGNITSTIDSDFLGVHST
SVTQDDVIANVTNVNLQTKTLEVLATNNSSYTAEAKIASNAVVGDTQAYIIGSTVNADPG
ANGEAITVLATDNSSYTARSRDLQQPNLDLSSLTRVEFGKASATNKVIKNTQAYVSDSSS
LNATNGNITINAANSQAIKAEANAMAITDFGLLGTLANLSSLSLGGTFALNEISGDVSAY
VLDSSITAANGNLGVNASNTSSIDATSEATAKAQGGSNTTGAFTFAFNSIGKPSPTVLLS
IAPDSAFSLGNLLGKTFETLTGIELGSDSEVIGADTTAYIKNTKINSGDVTVTADGAQQI
NATVSNISDSTGQALINSNGTAVGSLVASNQVASAALAFVEDALDADGKKLEAKGTLTVK
ATDRAGIFSNSKIVTSQVTTNTGGIDVLNDGAAALIPLFGNPTYTTASLTPGNSTKIINF
GDTVSLSMNFDKSLGESGRTYTYLGENGYTADLLTENYNNLDLWKELLATQIQNDGMNLS
DSNSVAIGGMVVRNEVDGGATAYIKNADIGANTVNVTAREEAVIQAVADATAQSSGGSAF
GTGKSIAGNGTIAVNSVLSDAIAYIENSEVITTGDIEVKAENTAQLGAETKSAINTGADA
YGVVLAFNTIGYQSQNLLYDTLDALFGLAPNEFDYETTDTPDLLQENDRVKVGDIIYRYE
GGDVANPDLSNSAQSYATSLLWIPVLPVFGNEEPAKVEAYIRNSDISTDGNLTVTANSLA
QIEARTSNSATAAASALFGANAMTMSGVLASNKVSSEATAFIDSGENATNTVDIKVAGNL
TISAVDDAAIDATTNMVAAASKKNDLGLGIINDLFNTLTGDYQYTSNSGTQGLRFGDKVR
LDDVDATTKNAPSVITQGDWIELSSDVGNGKEGQIYEYLGNTDINGTSLLGKVDFNTDVD
FTDGNWRLIAGKAGTVYQYMGAGGSTEDNRNLATEDYNNFEFWKELSENNVIPSSISTAI
LKDNKLDPGKAKSFYGVVARNDIDSDVVAYLDHAVLATPNDVNSGLANVVINALESVSLR
AIDTSVISSVSNSKGGVLTNNQLRSSADAYITNSSIQQAGGDGEVRVEATNVSALEATSL
TRSKGEESVGVVVSFNTLGWEASNVLFQAIDSLLGRELLTGEDPARAYAYIQDSTVTADG
DLHVLADSSAIMKATTGNEQASTPTNSFLINTAYGKKAMAAGGMLASNKVSSEAQAWIDY
SNDYTGSRTVTVGGTVEVYAQDKAGIVADSRLAVDAIATNNLNALVDVAVALGANDYKYT
TASGSVTVGEDADPNTKNLLVGDRVRLAEGSVYEFQGGTSGESIDLSQENFNSSRWEKVN
LGVEDLGLNIGNLSASDARAYGGLVVLNDVRSDVDATIRNTTVNASEVIVKAVENAKLQA
FMESSISASGGSAFKELGEGKVFAANGLIATNIVQAQADAAVSGGSVTTTGDITVAAMNT
SGVDATINAATLSGDTAFGAVVALNTLGWEASGVLLGTVEASIGDPLVSDIFGLDTGANA
TATITNVSLDIGGEVNVLADNAAKMNATVSNAASSAASALFDAGGKAAGGIVASNKVKSS
ATALINNEDLTFDPNTPSVDAGDNILVSAVDNVELYSNVKLVSSSITTNDGGASVLDEQI
SDALTVDFVSSEGQRNLEYGDRIRLANNHTAGGNAGSVYEYMGKGGNPADTRNLTTEDFS
NTDYWKEVLETQLIPQGNNFTPSDSQAVGGVVVFTELDSTVEAAIKNTVVEADGDIKVSA
TENALMETIADTTVESSGGDIFGRGKSQAYNGIIATNVLLTKADAYIDNAEVTTKNGGNV
IIDAVNNSQMDAQTLAATTSGADAVGVLLAFNSMGYDSRNLLFNTLDSLLGLSELTDELE
GLLVDYDLNDGISEPVNLNDGDWVKLITGEVYQAIGDRTNVNLNSEDYSDRAHWIEVKSP
FGNEIPARAQAYIRDTNVDSAGDIIVTADATAQLNATVSNDATAKAAAFYGANGMSGSGI
LASNKVSGLAKSFIEFTAEQGTIQAEGSVSVLADDASGMDAFTSLGNTATKTNQLGANLL
NDLVNNLKSEYQYTTKSGTQDLVFGDKVFVASDYGLPDNAVDPTQETVGQLFTFMGADES
SVNLESEDFSNFERWKVVNDDNLIPSKVAEAAVKAFGKSIGTGKSYYGAVIRNDVQGQVV
SYIDNADVDAAGNIVADLLSSETANELKVGTRVKLTTDIGAAKAGEIYEYVGEERLEAIN
LTTEDYRDRNLWRKVNAIEVSAVEAATMTAFDQSITQANNEAIGGLITTNQLQGQAIAYI
EDSEITTLNTGDVVVDAQNVASLDATSLTQSKASQSIGVVVAINTVGWDASNILFQALDA
LLGDTLLTGLVEDKQDGARAFILNSAVDAARNLSVTSDASAILNATIGNEQVSNTTNSFL
INAKHGKNGMSASGTLASNRVKSEAKAYIDNSESGDIVEVDGTIIIAARDEAQIDANTKV
ATQAITTNTLSDVVTLLGNLLPDGYSYTTASGEINLLNSSSDTALFNALTNTGFDRTISN
TETLVDALKQGFRVKLQEDINGGSSGEIYEYIGVDVNSPVDLSQQNYGDINLWQRQTKPL
FVGDRVRLGANYQGPNGEDYGDPGAVYKYVGQESSPTPIDLGKEDYTNTNRWQKITGGAD
DINDSYPNFGNLTASDARAYGILVVVNDVRTDVEAYIKGTTINAGEVKVQAIENATILAS
ADSNVTASGGSAFKELGEGKVIAVNGNIVTNLVQSQANAYILDSEITTTNTGTTGDLTVD
AQNTSAINATLLSTTDSGDKGIGITLAFNTLGWKSQNVLFNTVEALLGDPFISGALGGEN
PSEAKAFIKNSFLDIAGDLAVTADNSAQLNATASNATKSAGSALFNASSKAFGGLIAMNK
VNSGAKAYIETTADQPVLGADADEVIVGGTVIVKAEDNAGIYANTKIVASSVTTNDGGIG
VASETVNDFVPADFSTDEGTVDIKFGERVRLSDSYDSNLGKPGSVYQFMGTNEAGENLDL
STQNYTDAGFWKQVLETQLFPGGINFDESNSATVGGLVVLNDLRSNVEARIERITVTAAS
IDIDAIENATIQATADSTAISSGGSSFTGQGDSLAVNGVIATNGVLSSAQAFIQDSDVTT
TTGDVTVDANNTSTVDAKTLSATNAGAKGVGVTLAFNQIGWDSQNWLFNAIDTILGDPLI
SNAFGNQNPALVQAYIRDTDIDSAGGIHLSAISTASVNATVTNETETAAYSFGVGNGADS
LAVGVVISQNLVNSQAHAFIDTTDTTGVQNDIDAKNGNLTILAEDNASIISNSKLAAISS
TTNDGGLSLLTQFVDKLAGEYQFTDRSGTQEVGFSDQVRIDDVDYNSSTSDPAEVVAGDR
IKIDFNLADGTATQGQVFEYIGTSPLTTPDLDNLGANNYNNTALWKEVSFTPGGVYQFIA
DELYADDEVDYLSTDGTVAAIELGDRIKVKANNGDSQVGEVYEYLGTISQKNLDLSTIDF
ANDILWKLIDTVTLDLSSEDFSNTSRWRELSTVDLRQTIPGVSFNLTNSDSSSFGGLVVR
NDVRSDVDSYIDNSDVDVAGNVQLDALETATIFAQDESTVTSSGGSTFGGGTSLAINGVI
VTNLVLSGADAYITNSSVDTTSNGDVILNAENTSDIDATVNSIIKSNGTSVGVVLSFNTI
GIASQNILFNSIDTLFGTDIANEQPATVKAYTDNTSINAAGGISATATLNANINASVENA
ATTIAASFGDNKAISVGAIVSLNKLSTFVAASLDGNGTKSLIAGNGDIIVGASDESQINS
EVKATSIAVAAGVGSGTSVSVGLSVSRNEIRNVLQSFITDATSVQANNGSIVVSANEAAS
IQATSRAVAVALSGSLSDKSIGVAGGGATAVNVILGGANAFIANSPNVKAGRVTVTTTNS
ADIDATVGAIAVGVTLGSDSATAVGIGVSYAENRMGFSDIITRTPLDVQAYIRNSQVTAP
NGVTVSATSTANINATINATTVAAALSGGSATSVSAAGLLTFNYVATAVKAFIEGDTTTV
TTTGTDVVVTASDQSKVSADAQAVSIGASISASSSAVSAAIGLSLAFNTIDNETKAYIKG
VGTLLTSGGDVKVSATDTATIEAVSVAASLAAGVSLSGTGVAVSGGGAVAQNVILSKTNA
DLEDSVLGSAVNQVGAVDLDASSDAEISAIVGAASAAVGIGASTGVAVSIGVSVARNFIG
YGLDNDTSADINSDQNPTTLTTGTRVKIVNGPRSGDVYRYLGSDLSDGAGIDLDTQNYGD
TSVWEQINLSDSAAQVQATITNTSINASGALTVDADAEQTIDAIVIAASAALSGGGNTGV
AVSGAGVYAENVIQSVVKATVNGDGATGIKVDSSSLTATDASSIEAIAGAASLAASVGGN
TGVGVSVGLSLAFNEIANDVEASIKNADNGFETTSGDVTVSATSQGRPVFNASTSELSNA
GLSFAQLDDVAKADEDNPDNAIAEDTIDLIADQAILAKIRSLFTSQGKTLSFNDTVGTEA
KYTTNEAESQDLRQGDTVKITDDFTGTGQKGRVYRYVGSDRNNINLSNENYGNTSNWVLI
DKLKVTILEENQRWAVVDPDGTTYILNRNGNSLEVTQTNINAISAAASLAAGIGGGNGVA
VSGAGAVAENVILSTTNATIDSSDVISAGDVVVSAASNSTIQSTIAAASLAIGGGGSAGV
GVSIGVAVARNFIGITPGGSDRILPEVGATIKNSSIDSVGNLSLNAIGSQTINSIVLAGS
AGVAVGGKAGVAVSGSGVFAENEIDVDVTSAIEGDRAIDTAGGVTEGIRAHAISITAQDV
SEINAIAGAVSLAASIGGKAGVSVSVGVSLAKNTITSSVEAAILNADNGVQTTGGDITIA
AVQAGSIAATSSAASLAAGLAGLAGIAVSGAGAEATNIIHANTNAYIDSSTIESAGNVDL
DANSTSTIDATIISAAFSLAVGGIAGVGASIGAALATNKIGDGTENTGQVQAYIEDSSIT
NADALTIDAVANQEIDALVLAGSVAIAGGTVGVGLAGAGASASNQIAANIGAYIDGDGTE
GISVDSVTINTDDTSTITANTGSAAVAASFGLAGASIAVGAAIATNTINNQVEAYIQNAD
ELTASVGNITITADEIANITALTAAASVAVSISIISGGAGALAVTEAINTLTTHVTAAIA
NSTVTANGEVKVQAQDTSTVDSETIAFAGSGSFVSLSAGVVLAQNEIGNNVTAHITNSTV
TAEAEGDISVIATSTPTIETLSEVGAVALGFGGSGAGGSAETIINGTTEAYVDSSNLTAI
DNEIIVSADSTTTAKPEIKGLSVGLIGVTVMESQVTLDGETRAYLTGTSTVDANKLDILA
EDQVTATPVTEIGAGGAITISTTKSTVNITRTTAAEVSSGADITLTNGDLNVLATADISG
TTNTSSKTFSAADIAVNTVDTTLNNTTRAAIASGATVRSAQGAVKVDANATNQAESEIES
LGVGLLLKVGTSNPTATVNSITEALIDGVVTGITADGKAGNVTINATAVDQAAAGAKTAG
GGLISVGVANVAANITSTVSAFAGGTIQSANNIQITAISQTDADADSESSSGGAVDVTTL
NATATSNPTIRADIGSNAILEAGLGVVVNAVHGQDPPTFSDGSFSATTGVNSSSNTITFA
NNHGLLTGDTVTYNQNSQTTPVGGLTDGREYGIIKSSDQAFQLGTIFNSLDFEDNPVIDV
DRDTINFSGRHNLQDGDRVIYTANEAIVGGLISGKTYEVRYINDTTIKLIDPDNPPATAQ
KFSGNNINVGSDTTIISLDNHNFSDGQAITYRAPKATVFSSPSIDVTGTGEDFLTNADNN
NNIYLGAGHGFQSGDEVIYSSEGETIGNLVNGERYFVIYDPNTPEQIQLAATYEKAVGVT
DDNGTPDDTSDDTIIPITPLVLNPNKGSEASKVIHSLLKVTDQPIGGLSDGITYYVDHID
NDKFRLLDSNGNAIALNGTDSEDSSITLSGNHTLGTEGIDLTNAGSGSHKLVLDITSVGT
GSQRFEGVGGARAFASAPSGDGVVTASASGSSGGVVRVAGANTTATSTPTVAVHIMEGAT
VVANFIDVDATTKGNVSASSANSGGGLVSVGDAESTITVNTTSTLTLGNNVTLLAEDSIT
LNTQTDQNANVLAISDGGGLVDFADADITANLDYSSVITVGAGADLKAKNSLVIDAESRL
DIDAKADSDSAGLGSSADTTSEVTIGSSENKATTETRIGMDARLQADQITIQARTTKLDA
YVEAKSEAAGAGADADATANLDIFDDVNVTLDANAGITGSTVNINANHSGVNIRSRSDAD
TDALYGDADSNSRTDYNSQNTVTVASGATVAAGILNVTSNQNIINYDRRTNADVDVFGSA
DENESGEFNARRTINWNGNVTFIAAPAPNLLIDSNGTIVTAENITVNGGQGEGVTVTGET
ITIDAIANNNVGSANFNINNVGDRDNQSAGNGILTGSGGTFSSGSIFTGVEIVNKSDKKL
LIGDISLANSNLQPNVDLNAQEVNLTFNVGNLAPAGDIEIDILNEGSGDIEFQGWIDNPI
GLIQVENQGGNLLNNGGILRGNQIQLITAKGVGTSTNRTTIDLVRSANRPTDLNVTATND
LWLDITGRLRDTDANNAQFKGGTLTTLGNVDLQFQSSVQETEATGTAAGVKVSVNGGTST
TYQEFFRPDTSTAPSDLDFRLFADTSQAVNIDSGFTFDQINGVNINLEAANSETNDPQID
LIANTNHGDSGDISALFHGNLTFVETEGNLRVNRIQANAGDVVLTVSDGGILESTPGDNG
ATALVIGNNITLNATAGIGTATDFFEIDSSFNSLGHVYAEANNSIFLTETAGNLSLDGVV
SNNADVSLLTLSGSILDGIVETEDLADIQGTNLDLIVNGGSIGAVDNDLEIYGAGSYQQN
NSLQITTGIPEQGRLYSTATQDIYLKQINGSLNVMRVEATTGDIRLSVLDTQDTIAGSSD
PLPENFNLLAGNGTTIIGTAVTGGIVTAPNGSILIDAGDDINIPLSTLIQAATTATLRGD
YGGVDGEERDENIGTTITIEGDVQAPTVEITGGNEVDYIQLLGTAGINANGIITRLQGNA
GADRFFVQGTAIPLTLQGQEGADRYYLSSNAAKDLFMTQGFFDDHAVDPLTVLNGTLDTI
QATVTIETGLGGNGGTRDVVYASTIGSTNPVTGEITNANGVDTLTGLGMSGQIDLDIPAD
SQENGFQSAFLMVGLGSGNDTFRVKGLSAQTIAEVYSQSGNDILNVGNDNNSLADISGIV
TFKGGIGEDTLNVFGNATAPLDSQTGIDPDQLSAISITGLEMGNNGLLSTHTRFGAGYDD
DLGGNYPGAIYYATRTTTNGLDTISSDVETVNVQLGTGDDSFVIDSTYKGETNIFGNGGN
DTLTVSSTATGLEPNFTKRVDFLRGIVQLDGETLILDDSGDDNANIGTYRGDTVTGLDMT
GAVTFANVNVIEIRLGEQDDTFYVSKTDADLTTTLKTGGGVDTVYIGTVSGQETKGSLDE
IVGQLIIEGEGPEANDTLYLNDQDSNISQTYTFSNAITGTRQLQDGTNWPIDTTTFNRSG
IANVQYRTIENLVLNAGQENDTINVEGTHREQDVLGGKAASFTINAGLGADQIYVGELLG
NTGTYSLDNFAIDLENPTADSVKGIPLIINGQGGNDVLHFLDNANEANANLAFNQNSFAQ
LFPTDDSDDADGISDTFLDFYTTVLGEDPTTHNYAGIVLSNAGKNSSLNINSLTTETIRV
TLGSGDDVVQLTNNQYDHNITVDGGAGKDTFNLENAVDLQGNSVVFNGQAGDDIFFADFK
TGVSATNLNVTFNGGTNDIIGDKFRLAGDGTTTGGEYIPSSTDNRSGEIRLNGNQFNLTN
IEPLVVHGFPDFQVVTPDEQANLSLGSVAIEDLQLTSISLQVVTVDGVITWTQEQKLTID
DALEPLYLGSAVGNLIDSYGREIQRRKDDGKWVDSRGNVLTENNGRLYDSQNNPLSFMPE
ANAMAVDGNTMVVGAQLDGADYGVVYVYEWNGSAWKETAKLYPEDKAEAGQGFGYAVAIE
NNQIVVGAPKDDGNGTDAGAVYIFERSNGRWQQVAKLTPLDAEAGDAFGRAVDISQSVVI
VGAPGFGNNTNDSAYIFEGSGSNWSQTQRWNESGDLGQAVTVDGNYAAVGLPNSSDANGA
GIVKVYRNNNGSWSYTDTLTPSEANRGEAFGHALAMDGNRIVVGAPLWDGIGNSATDQGR
AFVFDRSGNNWERVARLTADGGLPSADASSEGRAGDRFGLSVALDGDYVAVGAPGYDDAN
DIDVGAAYVFYELPDLGSGNGKTWVRSSGASSSGRLMANSPAGSDPDAPLADHFGAGIAV
AGTKVIVGMPGFNDVNNSNQIVRGDVGAFRTFTTNNVLPAVTNPNLRAETLVNNLAGFGE
FTHYDPSTRTLFVAADDSNTVLSYVNEGLYWRPSTTFTGASGFGADIDSDGNRLVIGAPG
SNQVYVYTWTGEEWSNSPSSILNGSLYGNGRFGSSVAIDGSNLVVGAEDANLRYYSTNRA
DTGHEIDLGATGVIHTFKLNGSSWTRDRVLMPYRNDLPETTSYYYEPSGWNQVWIEGSGY
FGLGLHTQPSDRGYGLSNGRITLAPRTYALMVSIYGDNDMSYRVNNSFDSFTTVNHSIDD
NYDIDLLLVGTLNGSATGSVTISNNTYNYGLGNHTPPNGTYQQMSVSGNAIGVVSSVAGV
GYYKTLEGSGTFDFEDFGSSDNDTWFTLLSTIPNRDIFRESYSALRNSKWGAELDIVGNQ
VFVGAPGQDAVAVYDLGLSEYSPWRVRVMDGSSTDVFDTPTRPTYLDDEQGTGLGRAIAA
YNSSRFYVSEPLPDFNNWYNVTTYTRSGSNWTKGSSTSFGSEISIQGNRMLIGNPIDSNN
TGLTYLFDASSGSFLNLTLYPYQLNSSTNEMQNDLTKNRRFGVGSSIISEGHYIIGSDPT
VSSIPQTLYNFRQRGPAWTAIDTVVTPDKLKTAKLGVSMAIDGNTAVVGAQDYDGRGAAF
IYTQNEAGVWNLEATLQAEGIELDDKFGASVAISGDTVAIGATGANSVYVFNRIGDNWTQ
QTNLSNSASGFGSAVDIDVDTLVVGAAESASAFVYELNINTWELSNRLSYPGFFGYLSEF
GTAVAVDGDTIAIGSPGGRGTLGGLGPIFVDSGVYVYTDNGSNWTLQAGLKYSDAIIDDD
FGQSVDISDEWLVVGAPGDNNKGAAYTFNWNGNNWVETNKLELGIGQTNDYFGHAVTIDG
ERIVVGAYGRDRIINSNTVLEDTGEAFAYGYKNGNWRLETVVDPLDNEDTGAGDQLGYAV
AISGNTVMLGAPQLNGRPGLPIDTSGAGYVYLREVSPPTRVTDIINNEILLTGGQANVLK
GTVGGMTISDFNFFDVADVGVRTGNANDQITIEEAGLTALGLQNFSLETGVGDDTLTVLS
ENLTPPRAEGYTLSGDFGDAQSGDELPEGAEYVPVNGKFSFDGGADDNHLNVNVDADLRL
VDNLLTVNNFDELELKNVAIATLTGGAAGDVITVEQWSGEVHVDGAGGSDQIKIYLDQVV
DATVSDSGGNNADQLTLLGSVGDDYLVLHTNAVTLGTDNVVNYSGIEVLRISGQAGADKF
NINDADAQRVYVDGGEGSDTFNLRNSLTGGTFVSFSDSGSSNDVDTLHTPQSAAVNEIFT
VNQGTARYDETIEVYNITPVISSLTGDTNLNEGTPGTWRAIASDSGDDTLTYTWNFGDGS
PEVTGAEVNHSYRDNGIYTVTLTVTDDDGGETSRSLNVTVNNIAPVISSLTGDTNLNEGT
PGTWRAIASDPGNDTLTYTWNFGDGSPEVTGAEVNHSYRDNGIYTITVIVSDGDGGETSQ
SLNVTVNNVAPQLTVVESEVNIQEGQTAINSGTFSDIGNDIVTLTASRGTVTQKQDGTWS
WEFNSTDGPNETQTVIITAEDSEGARTQISFNLIVNNVIPSITSIEVPTSLNEGQEGSFS
ALATDVKNDNLTYIWDFGDGSTKVTGSAVKHIYGDNGIYIGTLTVTDDDGGVTSQQFNVT
VNNVAPVVKAGKAQTINKGGLINLSGSFSDVGTLDTHTINWDFGNGVTATGTLKPIYTYT
ESGSFTVTLTVTDDDGAVTSDRLTVTVKPFNQATIVSPPPVQPPLTVESLPVGIFLVNLT
GQITVDFLADAGTYNGELALFSLEGMDTLAPGSTEFVREAARRALSNSNLGYILISDSIQ
GARFQGELGEVDKNDGIYSAPITVQLNANTRFAFVLVPNGTVQEVFNNAAINGAKRPLFS
ISAANPRGLTQMGRLDPGDLNGGVFGFEDLRLDGKSDKDFNDIIFQLKGAVGKGLTLSEL
IAKGKVWSQTNLGQRLLKYALDNGTFNNTSPQLLAALVNDTGISQLDGITSDFAVEGNLL
SLTPITQLQASLLGTDGFVDILSQLKPDGSFVLSRQLLAQINGQNLQDGSYTLSLKAMNA
WKEEKTFALDFILDTTDPLAPTDITVDQVNTNSPLLTGEAEVNTWVELFNQVEILGKTPS
NGTWQIEATALADGVQQISVKAIDAAGNVSLPSTFEWRVDTKAPLLNVTSPIANAQLQLG
SRLQGTVQENGSGLANLTYQFDQGNEITVSVDDNGEFDQELNLSGVQTGVRILTLHATDI
AGNLTTNSIEVQIM
Download sequence
Identical sequences K9QQR9
gi|427728527|ref|YP_007074764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]