SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427728586|ref|YP_007074823.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728586|ref|YP_007074823.1|
Domain Number 1 Region: 9749-9886
Classification Level Classification E-value
Superfamily beta-Roll 0.000000012
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 8787-8862
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000000125
Family Crystallins/Ca-binding development proteins 0.0066
Further Details:      
 
Weak hits

Sequence:  gi|427728586|ref|YP_007074823.1|
Domain Number - Region: 9648-9713
Classification Level Classification E-value
Superfamily PKD domain 0.000667
Family PKD domain 0.0072
Further Details:      
 
Domain Number - Region: 9935-9964
Classification Level Classification E-value
Superfamily PKD domain 0.0301
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427728586|ref|YP_007074823.1|
Sequence length 9968
Comment hypothetical protein Nos7524_1346 [Nostoc sp. PCC 7524]
Sequence
MIENHDSLHNLNFLDSSTLHLGKPQHLGLSNPNEILFIDTNISSYQSLIDDINSNVEVVQ
LDPSQNGIFQISQVLQQYSNLSAIHILAHGSEGNVQLGSETLNSSTLSRYTNDLAWWGNA
LSADGDILFYGCNVAGNDQGEGFLQNLSDITKADVAASDDLTGNANLGGDWEFEYTTGAI
EAIIPWQITTLNSFESVLATISTDTNISSNQSYSGGLIIDGGNLIISGNVTLEIDGDFRL
ASNSKITGNNDGITDSLTIKLIDDKFASDKLKDSLEYLGDVNINGLIGGLGLNQVTITAK
NINIGDSATLLTRQISATDFNNGSYDTAISTGDSGDISLTARTITASGAKFFAHVENDSS
FATGGIKLTTYDKDIRAPLIFGWVKQLSQISLDDVTLKGGNIEITSLAEDIAYNSDIPAQ
VTEAFGFFGLDNSVLYNIQNIGIPLSMQARWSESYVKITNSNINSSGNVTISSKAVVDSS
VEAISMLGSVVERALSAKGLPLKFAGAGGYAKGVAETIVDGTTTIIAAGNVDVVSDVNTT
AVVEATVFGNVNAAFSSLLKRVSLPSNDATKNAFSAAVAVTDTTSKTVIETNSSITAGGN
VNVNAVGAVDSQARGRATIWVNGQLTVGTAINVDQTTIEAKVDGSITAGGLVQAEEIKTI
ENSRVDTNTITFTEKHNFKTGDQFIYNADVDPIGILNDGAVYEVLVVDDYTIALTVQGGL
DGVIDIDNSRVNHEVQHGFSPLKTLIFDGGNSDVVNADENTISINNHGLVHGQEVIYYAD
PETTEEQEIGDLQTEGTYFVIVVDSDTIQLAESRDFVVLNTPVDLTVSVGDQHILSTYQR
QQARTPEFDSARAVKTNDNTITVINHGLYTGQLITYNNNSGNAISVGGTPLTTGASYFVV
VEDENTIKLALTYQNAIEYQVGTDEGTVIDITDLGSGQQFFTYETSALQFNPQDSNQVDQ
DKNIFTLANHGLKTGDEILYEIDETIQTQEQTILNISFEPQDRNNFIDINHDTITVTGHQ
YNTGDEITYTELVGLGVSGNTLYAQPTILEYPIDNNAQYYVIADPNDNTLIKLALTAADA
TNSIAIDLNSDSSNVDANANTIRVTTGTVYQTGDVLTLNELTILLGEDTTTNYDATVDLN
TPLYKNASYHIIKIDSNTIKLAFTADDATQGTAINLTIASDLDLTNNRIYLPGHGLSTGD
ALTYEVDYLGRTGTPIQYQYNGSDTPLIAGQKYYVIVQDANWVKIALSASDAAADNYIDL
SVGSADALHSFTTTTPSFLAGDIPIQNLRGGGRYYAIAIDANRFMLAETAREAVLAAPIA
LKGEAIDIDTSSLTSGNHSFSEQEFLELEAIATDSTIDIANHGFINGQAVTYLGDPNRLA
STGGLIHNQEYYVIVVDANRVKLASTVDDAALGNYIDLTNFAQAVTAKLSFASNDPNVVN
LSNNTITLSNHGLSTGQFITYKHGSTPIGIAGNQSLIDNNRYFVIAIDQNTIKLASTYAD
AIAGLNIDLTTLGTGNQEFLVLRGHQLVHNQLTPAQLSFTSSDADVVNLSNDTITLSNHG
LSTGQFITYDINNHATGIGVVGSQRLLDGNGYFVIVVDQNTIKLADTYADAIAGNAIDLT
DLGTGEHSWHYGVSSLRFDPTNSAVVDDSQETFTFANHGLTTGDRLLYQGNTVRNQSIGK
LNSGQYYYVVRIDNDKFKLATTIEEALLAEPINGNHTLTTLPVTRGISVNAALTAEDVAE
SRGTSGSNPRFKDLITNVPLAALLAASTGASVINPKTIKDAMEKAQGVEGFPKYSLGLSI
SANYVNHQVHATVGGTLNSDADIVVNAAVEQFVQVGGNGASSGSDGGFAMAFTVGLYTNN
VKAFIEDNAIIDAAGSFAVTSSLAYPILIDPTKGLSATEWTELGFSAVFGGKLGLDEFVN
TFTVTKNKGKVKDNQQLLKFGFALSVAVNLFDNDSIAMIGSGARINQNRKNTTQSVKVSA
ITDITHAHVVGIFTLNLGLDVVLLGFYEKSPEDFINIYGNRAGKGIGVSAMLEGMTNTTI
AKIEDGAMVHTGDGGDGLEVTAKEEVFVLNLVQSGGQVDSWGLSGTGGSSVHASETIAHI
GSNTKITGGPVYLDADSDIKRINYLGAIQASAGSLGIGATVDVTKIIRNTRAVIGNEIEL
EDDSKIESIPDILSYLQVADALTIFSEKGEIKNFNTGSGLDINITTNTPPKAGRSVLDLN
ARNSGYVVSATLAGSLARRADTGSSFIGSSPTALLSDPSTSFGIGVAGSVSVRNVDEKAQ
SYINSTGNVRVAAPSTALGIALNSKNDTDFGAGSGALSLIKLQNQTTRLGLSGAVSTHDI
EHNTRAFIVGANVTTVGNVSLNAEEKSRMIGVAVGLGGARVQEGAAVAPADPPSTSINTF
SGAVSLTWNNFDNVVETFTQNATITLTQGNLSLKAKDESEIVGVAGAVNLSLVRGNLNNA
RSGAFGVSVAINEIDNKVRTYLTNSTVQAAQVTLDATSNAEIYAVSIGGTASDASSVSGS
AFSISGAGTGSQNKINSTVEALIQENSSVNTTGAVALSAIDDSYILAIAGGLAISSTRGQ
TSATALGIGAAISNNTITTKTKAKIDKSRLTAGSKVSLNSKSTAKIQAVSISAAGSGGSS
TTSSAFSFVGAGAGSHNEIDQTIESLINNDSEVITTTTGFGIDVIAINDSEIDADAGGIS
VALALGESSGTSISVGVSVAENQFTSKTRAKIDKSQVTSSWDLTLKADSTTHISAVGWTG
ALAVGSSSASQSRGLAISGAGVGTSNKINNTIETGIDNRSTVISLGNISMIATDDSQIDA
DAGAVSIALSRALSEKSSAFSGSVGISVSLNEIENSIKSYVDNSKIDTDGAITIKAYSTA
DIDALSIGGSIDGSSGASGGVFAGAGAGADNKIKNTAIEATIQNSSSVSSIGDIALEAKD
KSTITADAGGVAIALLSGTGGSVGAISIGVSVATNDIENSIKAYIDKSTVQSTTGGVSIT
ATLEEATIDALSIAGAVAIANTDASNSFHNNLAGGFAKLSLGLSGFGAISDNRIKNTIEA
SIRNSADVDASRDISVTAKDTSKIEADAGGVGVAYSRVIPGSPVAISATMGGSRAVNDIE
NKIQAFIQGTNTQVDSTNGGVTISATSSATIDSFALGGSIAVSGIAGKFGGALAGAGGEG
DNSIINTMEAAIKDSAVVKGKEKITITAIDTATITSIVAGGALTSAIAGASKTPLSIAIG
VALAQNKINNQVAAYIDNAQVSSTSNNIEIIADSDATIIARSVAVSIALSAATGISSTGS
QSISISGGGANAKNDILTNTNTYIKDSTIDSVTDLTLKAENTSQITTAVVTISASGSSGL
AIGASVAQNYVGDGNEIRAYIDNSRINARGNLTQTATFGLEDEETITADVGTGAGALGGS
RLGVAAARALSYFGALINFVEGVAKGAQPPAQPPAQPPAQPPAQPPAQPPAQPPAQPPAQ
PPRDYSIRPTPSAITGSLSGAAADNKVAVRVQAFINGNSNKGIAANNIILKANDITKIEA
NVGAVAIAASVAKDNNLAATIGASLARNSVENVVEAYILGTNNPTITARTGGLTLEAISN
ATIDAVAVGVSVSGAIGDKIAVALNGVGAETTNDIKNTIQAYIDGSKIVADTGLTTITAK
DTSKITADAGGGTLGFSLGGANANSVSIGVGVALARNTIENNIQAYINNSSVSAPPSSST
SSTSAPVTTNSISISAESAATIKTIATAVAISAALGNTGIALSGGGAEATNFIFTNTNAY
IKDSSIRDVGDVTLTANSHNTIDADVVAVAGSGAGSTGAGGTVAGAVTIGASVAKNFIGY
KAKRNAAGLIVPEKEVNDIRAYIENSSIQASGNLRQTATASGSITADVGAGAIAIAATAS
GTNFGLGVAGVLADNQIAQVISAFIDGDRDTGIVANSIALKADDTTDITARVGAAAVGFA
VLGQNSVAASIGVSLARNDIENEVTAYIKNADTKVETRTGELTLEAISNATIDADAVAAS
VSGAISNSIASALNGALNGVGAEATNDIKNTIQAYIDGSKIVGNGGSNPAANSGGTTITA
QDTSKITANAGGGTLGFSVGTGTSVSIAVGVALARNEIKNNIQAYINNSSVSAPPSSSTS
STSAPVTTNSISISAESAATIKTIATAVAISAALGNTGVALNGGGAEATNFIFTDTNAYI
KDSSIRDVGDVTLTANSHNTIDADVVAVAGSGAGGTGAGGVGGAAAIGASVAKNFIGNHS
DGKKNQVRAYIENSSIQASGNLRQTATASGSITADIGAGAIAIAAKASGTNVGLGVAGVL
ADNQIAQVISAFIDGDRDTGIVANSIALKANDTSDITARVGAAAVGFAVLGQNSVAASIG
VSSAHNDINNQVHAYIQNADKVEAKNGSVTIEAMENSRITSNAVAVSVSAAVSSGLLTGA
LSLAGVGAESTNIINNSVKAYVDNSTIETQGGNASDIKLDARNTSYISALAGAVGVAGSG
GFTAAAGSIGVSLARNLIGYDSITDNSGYGNEILAYIKNSTATSTGNIKVNASNTETIET
VSFAGSVAIAAGTAGLALAGSGAESTSKMASNVHAYLENTQATAGSDIEITATSDSQVTK
AHAVGAAIAAVIGEGGSVSVGASKVVNKIANSVQAYIKSDTAKTIQANTGNVLVSADVGR
ASISNVTAVVASVAATVKGFALSGGGVGLDNTINNQVDAYITGPVTVNATSGNVDILAKE
DAFLSSDATVVTIAASIISGALGVAIVENEINSSIQAWVDNDATTAWTSGTPITTTINSV
NTRVHADSVANIDKTLTAGVSASTFAGAGNEAKANIQTIVKAFVEGTRLTSTRDIEIKST
ANNRARSSANGGALGGLAVTAMVSDVNLGRGNDVNELEATIGDGTEVTANTLRIIATSTD
DLLAESVAAGAGLVAAGGAKSTLSSDYATIGQIGDNAQVTVKTLSITSSHTQDVDSSADS
YTYGGAVGNGAGVDNEITSKANVDIGANTTVTADNVIINAINRLTKDRYTNSVNSPIGLL
NSANLKSGSAGAGVLTVLESGTDIGTSSNPFAALVNIGNSTNITVNGTNANPGLLQIETL
NEVTAYDQVIIESAGVYALGVGLSRIDSNTKAGVNLNGATLENKTGDVYLTSRTDSSLAP
SNNLLILGAGSVNAGDAKTTTNATNEIKVDHATIKGSDIHLYAGRDSFAVPNLIDSFANA
EITTVSYFGVSIPVLNATINETNKVDITGTSNIQALEDVNLVANEGIGGGERARTDGTLV
NLAIPPYGFPLTPDASRPSIQANVNSTNQVNIGTDATIEAGINNKSVVQIKPLSLNGVEQ
LPSSKLGTLLSNDEKTALGLSLDTAYEYSRLDLNNITFSISTDTVVKVVANANQGGEVGN
YYQYQPITGGASDTIILQNEDFSNTARWTNLGATLTAEQQEAYTVYQSNVTQDLKAQLTD
KFYVIKPQDLDAVTLSYANVGNLLLEQREKILEWIANHSTKAEAIARYEVQLAELDTTLK
ELGLSEKIEVNGRNIQVIKRGLDLLFVNLPDIYAAPGSIFIEADSMSAGDFTSLLGNRLK
ARSGAEIDILNQSPFTLTVNDTVIRDNKRVTVIDGKYTVLQPGNVYVNNILVGGASVNVI
PNTTLVKYGDQVYRYIGNTTQRLSLSEVSYDTDAAWEVDINENANSFVPDATRNKFVAES
KNISIVQNAFANSAYNIGNLVIPQIDQDLYIIGDVVNEAGDLYINNEEGSINVSGEIRGE
NVTIQAVRDFNLNTEDWLHTNQDPRQYIDYNGARAGVYNVNGTPKSETYTQGSNVGEQTI
LGIKVGGQNLDAGIKRNQSAILAQGAIAVTARYLNINGLIQSGVDTVELEISPDFNPGTT
TQSLIDDDGNILAGVSFGTENVPVKGYFDAAQGAIVIEDIVPQGGRITLAGQILSTGNGQ
LKVANGYASVDINNESAYKLILNRIDTTTNREGIITLVDTYSNSDPKQFKKVEYTVSAGK
IKETKYTGTRREGTTNIDYTLEGSPISHSFSVTIQYRPTTGLQYVWTEGQEKTKVLVEKF
EKKSFNLFGFDWDDLAKDPGRRAWEQTTFRDDQPLLESESLAIATPSIPTVALIQNTSLV
RDVSNNKIYRYIDNNAELELSLQDFTDTSKWQDTGTTSTSSITDRLNNKFDSNYISVPIY
TISYEQRNDNSVDLIKDTSLVRDVSTNKIYRYIGNNADLELSLQDFTDTSKWEDTDTTST
SSITDRQNNKFDSNYVNFSRTIDNWTSGGGWFRKKTYHTKVTTITGLKDYYTHTLAADNP
IDIEFIQGSATPEIKIHARNDIYLQGNIETPDTGSVSFTTTNGSVTSAPTVAIFSKINNV
NVGGGFQANIEGSSHPLSLTAGGNIDVTAVSVDNASSSFVIGTITSTGGNVIINAQHGIT
PENSNSLITGQQIELYAQSGAIGTATNQPIRINSTTGVTAQANGDIYLLETSGDMKLGTP
SIGTTDLVSIKSVTGDIYLETTNGSIIDSFIEDPSVSSKLIGRSINPLLQAQIDAGTFTL
ESLQYPLSPNLYSFLYPNAEFLGVNQSLSSSENINISGRNITVKATGTNAQLGSISDKIS
IDFSGGYDSLSTANKQILSTATASDVVGVTYEIYTYLGDDATGVDLATADFTDTTLWQEL
QIDLISQTTRKVEQKVSILTGQTVLVQYEAAEYGIYKYLGDDATLDLSQQVYGNLRLWEK
VRTSYDTDTGRNVNLLNGQLVQNKAVVEHLTLQLIDDIDITVTNNLTIDAGDAVAVQSSG
NMKINHLNAGNDVRLQAAGDILDNGTDATAAITTTSGGLLLRTEGAVKGLTTDNSLRVSL
AADGKLSAEVIGEIHLKQVAENTLFIDQVNAGGNVTLAAPTAGILVNIISSTGSVNLQAQ
GSILAADQPNELNIQGSAIDLQSTQGSIGEFTNYLDIDGVINAAALQGDIYLNSPENHLR
VGQINTQFDVGLRSRSSILDTEDTTVDVIGRNITLETIGNIGTVTDVLEINTDSVNDGEL
TVTSGGDVYVQETTDDLFVNQVDAVGHADIAVISGDMRVGSITADTLDLDANNGLFIWGA
ITTANQMNLVAGTSRLQNYDDYLSVGLPDDLYLKALQPDNFSLFLVGTLTSNADDATVNL
EFSDDVILRGNINVNGSNSDLKIRSEGWVYIESFLTVEDKIDILGGYRADGSSTNTSNSQ
GSSIYVHGTSRVNTKQAGSSINLKGAKDVDIFGAVVAGGTINETGVTWAGDDSSITVTAQ
EQVFLDTGLLASKAITINGGVAGVDDHNLAVLVTPAGGATAAGFTSDNSGGLLTINSTGD
IEMMGTLVAGGQLNQTFDVDGNLLTQTVTWSRNYGEIKINSQGQAFIGGNTVNQEGTPIQ
TGGYLFANDRIEVTGGTHSSGTGTYIHAASELVTHNANSSIAIKSVQDADIQGLLLPGGE
VIPVRDANGKYMGRYTNNFGGDSTITITADHQIRIGQTLQAGKQIDLIGGIDPVEAGVDY
SGKGIVLFGSTQIETWQANSQINLNAPGEVAILAPAHTNEIEATGFYELATGVVSQDVTL
EIHIDRVDFEIVASVTLPKSATEDNQSVADLVADLQTALQGANWTVVTSQDTTTHPVGSA
YTGFSDADMKVKIREGRLMLTSSYGFKLIQSGSSNADLLGFTNLTSDLTSSLPYTIKAIH
SGSVVSIGSPTATNGKLYIAGKVIAESAIALYSGTSPDGIDIDLDSTGLLETINGSINLN
VGEYGVIKGDIIAGGTDADIILTANNTLKLHGSLTATEQVQLSAGKTIVPGETSIHTLGT
SKIDSRSLKITGLNNVIIDSTIGKDKTNMTNIEIAATDGDLTLARISGRIITNADIILTG
KNVNIEGVLRQTQGDGDSNTTELVIAATDTTTLMTDVISQGSISIVAGDDISAYNGQILV
QGTGEVLTINQTNANGSINLGRTVVVDSKYQQQGLDLVAINNLRLNSSGTVNIGSGVRLF
TSGDNSSINVTGDVINVVGSLAAGANLINDTRTWTGKVATINLNATDLVTFGGAGADGTN
IVTRGGSAAATGNININVSGGTNQLDLLMNSLSSIQSDTTARFGETETLTFTNDTDTSIN
ITAQGQVEIDGLIQAYDNNADITIDSAGLLLINGYLYAEDTLNLDGGTNAERYGLMLTPL
IYQDTQGRLVNSSGFYINAVGEYVDADGNQLAVRVAPISTTEDLDNLTRVSGGTLETGVG
GFINISAEAGIVLRGQVAPANAIDGAVRAEKVTIISENNTGDIFIDTIIDARSQVIVKGN
NLYLVDYQESNPQSSIRPNNALIKTYGSGSLSVTDPAIQIHGTGEVVIALSQAPLTRALV
DSHQDIEVIADNLWIQGYLESGAGRDITLNVVNAAEISGLVNADGNLAVRAGVDPNWSLS
TLRGTVTRSQLTGGNILINGKGTLQSTTGTVTLLAGGTVTVDADSTVGGNKPVPVPSINQ
RAITVPVVVGTKQVADGTIQVAVINWIPTTTVSQVGTELFKVGNKFYSIDATLTQDSYWN
PTTQTEREWFINQVDYTTNGINWAAYLATKPTNPNHSFKELSPEQKNAVMKSLGYYKLYD
FSFTNLKQNQTINGNTTVTDWNPSWKSTTAKEIINIQVDGWSDKYIRVPVGAKADLEDVL
GVVQSSSPYDWNEKVGYYWDTAQAKYTQDRSVFTPDIKNGVWLVDYDNSEGRWAVSYHDN
TGNRQYAINERSDTPVHRQDPNWGGNQVGYDYLGRYVFAPLDGYLSKTAALSFDSTFAIR
DNVVVGYSPREQYSDGWYTYRPFGDVDSLDLNDNFITVYTHGNYSGAALNIYTTDYFYLG
DVPGFNNTVSSIRIPSGMRATGYEHGWVDPSRRGAAYLYTSDTPDVRYGGQYVGYNGDPN
NNPVILFNIRWTNVHPSGLNDQYGAFKVERLYRVWTGGYLTETQYDYLYNWTSTTTDIED
PRQTIQYRWTGKDEDIYDNRPVFETRNFITRNVEIKTENKYRTENITEDQTIWIVERSDG
GKNRPFGKFDNDSIRAVNGITIDAGGKVNISGQVLTTGINANITITSGNDVEVKGKLPIG
ADIGTTIAAPAVISTQNNLSITAANINVSDLSELRANGNNGKINLTTNSATGDINFSGNA
IAGNIGTNGSQIRFNAGNDLNLAGFASANNSITAHAGQVGGNGNISGDAFTYLQTGSTGS
ITIRAGVTTGNIDLPSSWLDTGKLTMTASQGSINNYKFNNDIRQHGLITANTTNLTAKSG
INANLKTNNLVVTNTSTGNIDLTIDKKDSSEVATTVTTNNGDITINAISSIRLQNVRGLG
SGNDITVVASGAVTIDRLQAADNLTLKATGNLVLDLDEVAYLSAGNLMTVAANHITRNNT
NNISANTLALKTVNGNVNLYTQVRNLNLVAGGTGNAAINNSATNLNLTSVEIGNGDFTLT
TTGTLTATLVKLMNNSQARTFSLTANGDMSIGQIDAGLFSSYDNSGNPLNFSQINLTANG
GGDIVALNDNDGIAELIAAKANLTTNASTGNIGLIEVNVGEITANAYGDVKIKGLGVIGN
NNRTLSVDSITSTTGNILVSNIGTLKTSAQLTAGASRTIDLSSETEDLIIDLLNTSDTDQ
LLSSHTLNLAAAKQLDVNQNIVLEAGTLFLEFGKLSLIQGSVKLPTINVAVGTPYIINFL
ATEPGNEPTFEWRIDWGDGTIATFGSNTTFASHIYTNPGQAQIIISAVDEDSAPKNISIT
LSTNQVKTVGPNTIFQHTETKVDRSNLVSITGQFADIELTDTYTVTIDWGNGTTSNAVVD
ATTGTFTATYEYKVISGDGSRSAVNGNSGDDRIFGGVNSKTITGGVGDDEFVYTDLNQVG
HRIADFEVGSDKINLSQLLDSLVDGGYQGTDAIADGYVRLINGSTRTVTNNDGSLTKIPS
TIVQIDRDGQSGSAMFRNFLIIENVALEDMKNPSNFIYDDVDHYIVTVTVTDNDGRKYTA
TTTVSKLI
Download sequence
Identical sequences K9QPX6
gi|427728586|ref|YP_007074823.1| WP_015137680.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]