SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427728931|ref|YP_007075168.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427728931|ref|YP_007075168.1|
Domain Number 1 Region: 39-84
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000759
Family GSPII protein E N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427728931|ref|YP_007075168.1|
Sequence length 404
Comment type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Nostoc sp. PCC 7524]
Sequence
MWSSEGKAADTGASRQQQINTASNNGEQESEREQIFHLIDSLLSFEACLYHQILPLRLEN
NQLLLGMVHPQESGALDYVNRIISYLHYTMVTQEIAADIHRTTLSAYLNYKNTAHIDQQS
TELLTIPGILEQSPNTTAKLPDAVPTRSQEMHSPNTQHSSEQPGDVSVSPTAKNSVPHSH
VVPTHKHEPEENVVFSDVTVLQVQVPDISTSIESLLHLPPKKLLEELLGRVLTGGIGRLY
LERQPYQGRIIWTDNGVLQSVLENIPLSLFQGVLNELKRFAALPVSRLAEPRQIEKECLY
QQSRVLLRVRVMPGVNGEEATLQVLRGAALKFYQQQQLAHLSRDVIGISQQLSYKLHELH
QRLLLNPSLKSEQSEAIVALNRIVENLDQQIKTLAANHQLPIDG
Download sequence
Identical sequences K9QQY2
gi|427728931|ref|YP_007075168.1| WP_015138023.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]