SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427729430|ref|YP_007075667.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427729430|ref|YP_007075667.1|
Domain Number 1 Region: 388-510,753-817
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.35e-49
Family Intein (protein splicing domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 189-373,812-875
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-42
Family RecA protein-like (ATPase-domain) 0.028
Further Details:      
 
Domain Number 3 Region: 14-126
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 9.55e-32
Family N-terminal domain of DnaB helicase 0.00023
Further Details:      
 
Domain Number 4 Region: 587-699
Classification Level Classification E-value
Superfamily Homing endonucleases 4.19e-16
Family Intein endonuclease 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427729430|ref|YP_007075667.1|
Sequence length 880
Comment replicative DNA helicase [Nostoc sp. PCC 7524]
Sequence
MAEELSFESRGSDRLPPQNIEAEEAILGGILLDPEALGRVSDRLAPEAFYITAHKDIYQA
ALRLAAQGKPTDLLSITSWLADNDLLARIGGRNKLAALVDRTVSAVNIDALAGLVMEKYL
RRQLIKAGNEIVHLGYETETELPIVLDQAEQKVFGVTQERPQSGLVHIAETLINNFQDIE
ERNQGIALPGIPCGFYDLDAMTSGFQRSDLIIVAGRPSMGKTAFCLNLAHNIAATMRLPV
AVFSLEMSKEQLVQRLLASEAQIESGYLRSGRLSQTQWEPLSRAISMLSEMPIFIDDTPN
ITVTQMRSQARRLQAEQGVELGLVVIDYLQLMEGAGDNRVQELSKITRSLKGLARELSVP
VIALSQLSRGVEARTNKRPMLSDLRESGCLTGDSLVTLADSGAQIPIRELVGKSGFAVWA
LNETTMQLERAIVSHAFSTGIKPVFTLRTRLGRKIRATGNHKFLTINGWCRLDELRPQQH
LCLPRHLPSHGHQTMTYAEVALLGHLIGDGCTLPRHAIQYTTREIDLAENVAFLAKEVFG
DAIVPRISPERAWYQVYLSAAQRLTHTVRNPVAKWLDSLGVFGLRSHEKFVPQELFSQPQ
ELIACFLRHLWSTDGSVKLLRGKRPRPIAYYASSSERLAFDVQTLLLRLGINATLKLIPQ
VGKGRNQYHVKITGKSNLELFIQKVGAVGEYKLSSLQQISEHLEKCIHNPNTDVIPKDVW
NTHVVPAMQADGLTTRILQSQLEMSYCGSALYKANLSRERALKVAKLVKSEELITLAQSD
VYWDEIVSIEFHPEEEVFDLTVPGFHNFVANNIIVHNSIEQDADLVIMLYRDDYYNSDSP
DRGIAEVIVAKHRNGPTGTVKLLFDPQFTKFKNLARSGNF
Download sequence
Identical sequences K9QR15
gi|427729430|ref|YP_007075667.1| WP_015138515.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]