SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427729711|ref|YP_007075948.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427729711|ref|YP_007075948.1|
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.00763
Family FeoA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427729711|ref|YP_007075948.1|
Sequence length 63
Comment hypothetical protein Nos7524_2512 [Nostoc sp. PCC 7524]
Sequence
MEIGQKVKVFRLRDRVSTGIAQKLGKIGIIEGYKVTDGSGVGVVVKFDDNTATWFFEDEI
KAV
Download sequence
Identical sequences K9QT91
gi|427729711|ref|YP_007075948.1| WP_015138790.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]