SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427730150|ref|YP_007076387.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730150|ref|YP_007076387.1|
Domain Number 1 Region: 69-268
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.35e-40
Family Protein prenylyltransferase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730150|ref|YP_007076387.1|
Sequence length 280
Comment hypothetical protein Nos7524_2981 [Nostoc sp. PCC 7524]
Sequence
MKLRLLEQGRVKFNKILTIGVFTALSAITIVSCSNTKDVLVTEIGVNPPSRRASKNSQAG
SAYIQGQKQHAQGNLQAAIASYNQALSQDPEYAAAYKARGLTYFDLGDKQKAIADYNEAI
RLAANDAEAFNLRGNARASLGDQRGAITDYNEAIRLSPNYAEAYNNRGNALSVQGDKSGS
IEDFNQAIRLNPRYAIAYNNRGNARAAQGDLQGAISDYNQAIRLNRNFGPAYNNRGNARA
AQGDRQAALQDLQKAADIFQKQNNNDLYQQVMNNIQELGQ
Download sequence
Identical sequences K9QT37
WP_015139225.1.5551 gi|427730150|ref|YP_007076387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]