SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427730429|ref|YP_007076666.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730429|ref|YP_007076666.1|
Domain Number 1 Region: 6250-6534
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 6.2e-31
Family YVTN repeat 0.00085
Further Details:      
 
Domain Number 2 Region: 7474-7625
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000133
Family Serralysin-like metalloprotease, C-terminal domain 0.00081
Further Details:      
 
Domain Number 3 Region: 6447-6671,6701-6714
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000229
Family Serum paraoxonase/arylesterase 1, PON1 0.059
Further Details:      
 
Domain Number 4 Region: 7144-7258
Classification Level Classification E-value
Superfamily PKD domain 0.0000000523
Family PKD domain 0.004
Further Details:      
 
Domain Number 5 Region: 6856-6973
Classification Level Classification E-value
Superfamily PKD domain 0.00000017
Family PKD domain 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|427730429|ref|YP_007076666.1|
Domain Number - Region: 6787-6886
Classification Level Classification E-value
Superfamily PKD domain 0.0011
Family PKD domain 0.0071
Further Details:      
 
Domain Number - Region: 7277-7351
Classification Level Classification E-value
Superfamily PKD domain 0.00157
Family PKD domain 0.0088
Further Details:      
 
Domain Number - Region: 6988-7071
Classification Level Classification E-value
Superfamily PKD domain 0.0228
Family PKD domain 0.004
Further Details:      
 
Domain Number - Region: 7649-7678
Classification Level Classification E-value
Superfamily PKD domain 0.0294
Family PKD domain 0.014
Further Details:      
 
Domain Number - Region: 7357-7455
Classification Level Classification E-value
Superfamily PKD domain 0.0942
Family PKD domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730429|ref|YP_007076666.1|
Sequence length 7682
Comment 3-carboxy-cis,cis-muconate lactonizing enzyme [Nostoc sp. PCC 7524]
Sequence
MEGFVIELGSLPTLGIDPLNSSPSISIDPLVNNKITFIGSDGWDELYLKLNQNNQLAYSI
DGTNFFNDLNLATTQTDVLGAFAGVNIEVNLQEGNDKLYLDTSLVDALKQQNGTLSFDSG
DGQDTLFGPDANTTWYITGLNIGNFDVVSFRNVENLTGGTNNEDTFIFSANGGISGTVAG
GDGGFDSVVLDGGSFNSVVYTSTNRDSGTINRDGDIITYIGMEPITDNTNTPDRVFTATG
IADQVRVYRSAPGKITIESSNSTFESVTFNDPASSLTINTELNAVGSDEYVYIEALDNFN
ADLIINGGLGPEKVVFKGNLNLNGNKLEVTADTIEVSENVIISTRQITSGGDPETAVSIG
NSGNITFNATGEPSFIFGGGTRGIEVKSGAKLLAHSTGTFTPGNVSLTADITNLVFNYLV
ANDIGVMVQNAGVTVEEATIKGNNITLSAKAGDVNLINQLNQELNGNGVFFSGLIQSIVG
PLDDFLSLPLSVMVKVADANVTVKGASKIIASGDVDITTEANADATGEAIYYASTGVGIA
FSFNFGQTTAKTSIEGSTLIDTSTMNGGNVNVTAKTNNVAAGTARVTQNFGVGPTNPKNV
QFAGAVDVTRSFTHAITTKDTEIIAGKSVAIIAEAQYKDKSNVETASYYDGKAGITVSVG
VSESDVKATVDGKITAETASDPASQVPVKLTFNPFTRLNLADDTISFVDANGQAITHNLQ
TGDRVVYSSGVGTPIPGLEDNTSYSVIRVDEHKIRIASSKTDAQNNLYIRFGDYPTLETG
RLKRQITDIDTANDSINFGVAHGLTNGELVRFNPVSDKPILGLNNAIAQTYYIIKVSDTE
IKLARNFQDASATTPVGIDLELDPLVDWTSLTTDLPTLSNTNLNLPITKVDETENYIEFD
FDVKAYNNQQFTFTAVPGKRIGGLVDGVTYLAVVNDSNPNRLYLKTQGGQDVDLNLDFQF
IRANSQSITPSGVEVAGNNIIFDSAHGLTNGEALTYQGALGLTLIGLVENQTYYALVNPY
DNLAIRLTPSSADANAAQIAGQTAYNDAYENIKQQALHGTIAPEYQTVYDDAYEQAINNG
QDEAAARLAAATAVADATATVLGADWFWAGSGTASSGVEPPTGGTAVTLDAANDTLTFTF
AHGFVLGDAVVYNGVSSGSIDNLQLGRIYYILPDVNNANRLQLAATREDAIFGRAVDIGG
VANTDLFLARTTFVTGSVTLEDASDKLVFDTPQTFQRGDRVVYRGAVGGTINGLTEGQVY
YVIPDTQNAAKIQLANSYANAQTGAAIALDGITTPTAIFFTKEPLAVTIDSQNHTITKAS
SWPYTQNERVIYRGTGGDAVIPELTIGATYYVITGTDPNQIQLAAAEDGPAIAITSGSNE
TTLWLETPREDQRPYRDTRQSLVIDFDLNDQILIGTTHSFDPGAKGITISATLNAENSGK
TKSGIGSEPKIKDFLTKGELLGAGGGIVRNLANLNPFVFFRKDITTKNSNPNKNPASDNI
KNNLPQGSTTPQFEVAGSAVFHFTFNEVLAEVGPNAILNSYGDVAVNATLTHKTQQNVEA
TISRADDATPDTSISVGLVIGAYQNKAQALVRGKNNISSQETTGPGAVINAKKTLSVTSN
ISYPWVFPIRDPNTAATDAKNFFGSDPVGRFASFLDGKLGLTGLLFNSWVRTTNKSSSTN
ASTADFALGLSLAGLGYTNITEAIIESGAKINQDTAFRGSDQAVAVTADTKYELVHHTGN
FDIDLSPEGILKSRRKSSLSYLYNASGTQSGGTGIGGAVHVLVVDNTTKAKIENDTQIYF
TKAYDPTAKTGGLQVTANTAILNIALGQSGSAAKTFGFAGMVNVDTIFSETVAQIEGGSL
ITSAAVAGTDIYVDATDTTVMVNLAGSTMKGERKGMGFTGTVNVLNRETYAVIGALPGET
QRISTIDIGGELQVKAFNTGALISASFAAAIVAPGAASPPGTSSSNSKANSAVQQANQAA
PSGDAANQGTYGIGVSADAALNEVVKDFAYAVINEEAQTNGGKNIRAKKITVTADNDTGL
GAFAGAVAAAKSPAGNDIAIAGSFTQNTLIGETKAYINDAVIETENLTVEATRTGVIASL
TAGASVAPGVQANSVAGSVSVNVITNTTTAYLGGLTAMLMGDAKINARDETLIVSVAGAV
GFGGKNGVGAAIAVNVIDNTTKAYVEDSTITQQGGKFEVTSSIDNPGPGNAKIVAITGSV
GVSSQGSGLAGMIGVNVIADEAEAYIKNTTFTNPTGTSLSVTAEDNSWIFGIGGAVGAAG
QGVGLGAAVGYNGIHSTVRAYLDNADIGTATQAYDGSVLVKADNRAVIGSGTVGAAGSKD
TTIAGNVSVNVITNTTEAYIKGGSNVYAKGAIAVKAQDDSTVGSVSGSLAIGGQGVAIGA
ALSSQVITNTVKANIDSSTVHSTTSTLEVTADSSSLLIAVALAGSGGQGFAGAGSVTINL
IQNTIEASITGDTDLNSDGTKDKSHVQAQESIRVAAADSSTMIVISGAVGVSTNSSAIGG
SVSTNNLLNTTTAKIDNSIVTSVLGQIEVKSGFEIPTDAPPTSINLGTTTVAVPEIPSEV
TSQVVSVSIGVGVANWTAIAGSVPINIIKNTFEAKIKDSQVTAAGDIIVHAVDNATVGSG
AGGLSLGQDAAGAALGSSDIINEITAAIENSTVTTTGGNVDVLALSKADITTVSLGGAAA
GGFSLGGSVSVNVVKNTIDAHISGSTVEASKTVSVVAKDETQINSGAGGIAFSAGTTVGA
AIANNDIINTTKAYIDNSSVTSSTGDVRVQALSTSDIYAAALGGSPALGTAISGSIVVEV
IKNTTEAYITGDAGDRIVADGNVIVEAYDDVKIGTGTGAFGGGGTSSFGVSNSTIVTDNQ
TTAKIGDNITVIGRGNRATFEIFTGKKDSNLALAGQAQKEAVRGVSVTATSAEDILSLAV
AGQGSKGAGVAGSAPVTVLKEVTTASIGHGAKINIETGVTANPGQSVNVKAVDYTRLIDT
AGGVGGGGTTGIGAGIGVGNITKDTQAYIGNAEVQAAGDVKVQALSEETIISVSIAGGGG
ATAGIAGAAGIHVINNTTRAFIGDDPKDEVTPSGKATINADGSVLVAAEDHTDITTIAGS
ITGGGTAAIGAAVSVPVITKTTESFIGSQAEVTAKGFGSGITVNTGNFDTNSNLGILNAD
DPSLPAIASVTFNPATAVNNSNNTIALNTDLQTGQAVIYDNGGGDSIGSLVKGGTYYVIK
DATNRIKLASSQANAAAGIALDIDPTTATGTAHTLTAIPSRTATAQKQEGYRGVAVTAIN
SDKLLGVTVSGGGAGSVAVNIGGSVNVLTNHTSAYIGDGAKVTASNVFNVPNQEPSILVA
AGNDFHHLGIVVAVGGAGAVAVVPGADVLVVNNNTLAYVGDNAELTADRDIYVKAIASED
ILNVVAGAAGAGKVAVGGAVSVISLNNTTYAYIGDNNAQDQQGAKATAGGNILVAADDTT
TMTTGTGGLGVGIGAAGIGGSVGVSVIKKDTQAFVGHFSEINAQGNNAALSNGVYDGDIS
NGGFTTQTGFKGLDVQASSQEKIVSIIVAAGAGKFLGLAGAVTVEDIASNTVAYIGASAT
VNTAQSVNVSAVNKATFEAKALGFAGGAGGISGSVDVGNVNNNTNAFIGTGAVVTAAQSV
DVNALSYKNINSLTISGAVGLGALTGAISVWSFGTALDSQGGLSSDALQKLTETLTEAAN
VSSAFGSTIQRNFDVSQAVDYTTDTITFQSAPGFATGDAVVYRKDANSAGSIGNLVDGGV
YYVILKENNQIQLAATEADAQQGIAINLTSAANVTGTHQLTLNLKATSVALSGSGSPTGI
RLGTVAWIDGVVTAGDDVNVRAHEELHLNNTAGSGAAGLVGLGGSVVVANIKSVTDAALG
GNARVTAGTQTGDNVLVSAKFTESLKGFAVGGRIGAVSLGAQVVILTDNSEQKAYVDAGA
EILQADEVKITATSDRKVSAENFGLDIGGLAAGAAIARVNIGGETSAYIGDGTSGFNVQM
GQADGPKIGSLIVTADSKIRPLDNQWMAKTKAVAAGIGSGTGNDAKATLNVKVNALIGNA
AGIYATGDVKVNAISTTKATVNTDGFTVAGIAVGFSLSEVSITPVITASVGEDVVIIAGG
NFQLIADSTNEADADSKNTGGGGVPIYRSNSTISINDQTTASVDDRSAIAAGDNLEVTAK
MSTTANSPEAKAEAGGLGADTRTEITTTLIDETKTNIGNAVELTANVVTLQAVVTKIDLT
PTATAISYVIGATSNATATLTTTSTAQVDIAAQAKIKGTNQVKISARHDELKTNSKTSAT
TEGLGADTNSTATTTQTTTTNVNTGTGSEIATRSLLVEANTPLTISFAATPEQNGAVIET
GEATGNRTLSLNRTIDFNSKIVMLGAPSPTLEIDANGNVVRQVNVNVQQTPTEIIVDDIT
NTNTLAGTIIFSMQESVYDTTTTPVTIADEAVIRGNATVEFITGFERVDIINRSTKHLKI
NDIDVLNTSGQLNSNITVNVRNQAGFNYTTTTNPGNTAISITNTSNADIRLNGFIDNPFG
STQILNNGGNIITSDPTAKIETTALTLQTDNGSIGTASNRIQTQSSALSAIARNNIFINE
FADDLTINQVTSSNGNVDLQAQGSILDGNDTATADITAQQIKLNALNGSIGSNANPLEVN
ATATTAGLTALAQQNIVISDIEGGLSINDVTSIAGNVQLTLPDLASQGQDLVLGNGSKIL
ANQGTVNLLVGDNVVLAAGSTVTAGSTVTITGDWTNADLEGTVIELAGAIAASSVLITGE
VDGDVITLRNVNPGVTTTIETGGGDDIIYIGSQATPQANTDGILDNIRGQVIIRGGTGTD
RIELDDSADSKINTGTITNNRVTGFGMNLGIQYADIEAMQISLGKNANTVNIHSTQDNTA
TLVNIGAGTNTINVGNTNNQVNEIDGLLEIRGGTGTDTLNINDTGDTTTNAGILDSKRIT
GLGMGATDQTASNLERGIVYSGLERIQINLGNGNDQFTVNGIDTETTINTGAGDDSITVG
NELPRIAARLLVQGGLGVDTLLVNSNIASDLTLNRGVITGSDVPGRIEFEQITALTITQS
DSNDQFTLLDTTTPLTLNTGGGSDQVTVVNTTAAVNLNLGDGDDQVTVLNANAALAINGE
GSDVDRLIIDRSSQTAATIGGLLRDDTQADTGVIENLTPGDISFRAIEQVEMKLGTGNDD
LTIDTTLANTVVTVKGGDGDDAITVRSIGSPETNISGELGVDTVTVIIDGVPTDNQFTNL
KLDVETLVVDNSGNSSQPLDWTLKNGEILEAQLAPGTLPISVINTEGAELTRIIGGTQAD
TLNVVSETTNNIEGLIDGDRVELRSGLTVLEPVDFDSFRNYDTVIDFDKLQGNASSYTED
GFQIASTRTFSFPLPLGPITVPLPILRDDTISPAAKVQSINDQVIEDRFTFTSATGGSFA
LYSLSLAAPTTQSVTFTGTTMNGATVTHVVSVAGNTGFQTFNLPTSFGALRSVSWQPGTT
LVDNIVAREQFANIAPTTITTSTPTLNLTGDILFDTDNLAIYIDSDENGNYEQVIRNNDS
INGAKLLTSVVNGNIAQFRFGGNINFADNTSVPGNSIVSGFGSRGLSLLAGNDVNVGAGV
TFNFSANGTTPGIGGGAGGGAGGGGNGSNGGGGGAGGAGGAGGAGGTGRDFSVFESSTLE
NGKNGISGDSGVLGSGSITADRGQDGGDGISGINSPNSGGDGGTGGNGGTGVSGRFGGFG
GTRGTGGSLGDFASGGRGNDGSGGGSDGENGVNLDGFNGNPGQPGGSGSLGQNSGSGLTI
SGGGGGGAGAGGGGGSGGSGGAGGGGGGGGGGGGSGSFAVPFAVVVLQGGNGGNGGRGGD
GGQGGKGANGTPGGNGGAGGGAFEIIAQGRVNTPSSTFSAQGGNGQNPGAADTSSRAPGT
KNANRNNGRTNGGNGEDGGLIDGGNGGNGGNGGNGGDGGTGGLGGAGGTGAGGAGGTVKL
YGTTVNAGSATVNTSGGSGFQTGGNGRLIIGSNTHTGSIPGTRTGANTSFFNGQRADNPY
LNSFTSTQRSTPFIAGVAGGANTYGILSGLDGRSLDYDLSTSSIIDKPPADALIAVYRLD
LGPTGFNQDYGTYGVNGTKTADFDMLLFINLTDTVLTNPTLGILPTNLTSTISQNLLTAG
INTNPIFGGTGGAQTLTALNPGAVWATLIPNDAVKVNATITGPITSINNTTLIDGQVAYI
RAARPDLSVTPNITGLQSIALSPDSKQIYGVNPTQNALVVVNANDLSQRQLFKDGLEGVD
GLAGATDVVMSSDGNYAYVTSPGDRRIAIFQRNAADGNLTFVNTVGVFTFPFGSGQGVFE
TIALSPDGNSLYTSGTNGIVRYSRNSATGGLSQSTLVTNPDGIGNFSNLKVSGDGSLIYA
VSRSSDSLVVLNASNLSLIQRISGTANGLDGAKGLATSPDDRFVYVTGQDGNTLSVFQRD
TTTQTLTRVQTLQNGVNGIRGLLGASDVTVTPDGRYVMVSGTDSNAIAVFEHDTSNGKLQ
FVQLLRNNVGGAVGLRTPTAIATNATGNKTFISSLGTTGINGGLAVFNTNTLLPEPVTLL
TTFDNIEALAVSTASGEDIITLRQAPSPEVVTTTINTGDGDDIVTLQALSSATVVNLGAG
NDTAQLRANTPRTNLIVRGETGDDIINIERVGEFSRTEVFGGDNRDTVRVSGANLPTSAT
TIAHGDNPNGVPQNQGDILIFDPQNPNPNTPNYTPAPPTPGAGNINVTNRGVLQYDTFEG
NVIVIAAPIINFLNQPYQIAEGQSVTLRVNVTPLGLGNSLSEPVAWDINGDGSFGEADGA
TLILSWAQLVDLGLADNGTYQIGVRATNSDGFSSNALTNLTIINTPPTIQVSGANEVAVG
TPYTINFSATDPGNDRVFEWRIDWGDGTPIEIFGSNTTSATHIYTNPGKAQILVGAVDED
SAPNATFAAPKTVSVIVSANQVNAGGPYTIAEGEALTLNAIAVGTPTAYSWDINGDGIFG
DATDENPTLSWTQLQQLAANPIQNNGTYNVRVRVNYGTDQQATSNAVNLRVMNTAPTANL
VNSGAVNEGSTTTVSFIDQFDPSLSDTTVGFLYSYDFNNDGQFEIINSSSSSVVVPAQFL
SDSGIKTIRGVIQDQDGGATELFTEVTLLEVSPTLIISGADSAVEGAPYILNLSATDPGN
DTVSQWIVDWNDGTVETFAGATQSLTHRFTDNGTRVIVVTAIDEDGTYTATKTVTVSNTA
PQLQNLSATTALEGGTSRLTGRIVDPGIQDSFVLVVDWGDGSSETFNLAAGTSDFDLSHQ
YGDNQDYVITATVTDKDNASNTATTIARINNAAPSIAALVLANTTVTENGLVVVTGRITD
AGIGDTHTVVIDWGDGFTSAATVDASTRTFTASRRYADDNPTGTAIDNYTITATVTDDDG
DSGTASTIVTVTNVAPVITAFQRTETKLNRSNLVSITGEFNDVGLLDTHTVTIDWGNGTT
SNAVVDATTGAFTATYEYTVISGDGSRSALNGTSGNDRIFGGVGAKTLTGGAGNDEFIYT
DIRESSHRITDFEVGKDKINLSQLLDSLVIGGYQGTNAIADGYVRLVQGPTANSTTIQID
RDGSQGTAIFRSFLIIDNVALEAMNNPNNFIYNDVDNYIVTVTVTDDDGGEDTTSTTVSK
RI
Download sequence
Identical sequences K9QVF0
gi|427730429|ref|YP_007076666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]