SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427730478|ref|YP_007076715.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730478|ref|YP_007076715.1|
Domain Number 1 Region: 26-255
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 7.59e-52
Family Isochorismatase-like hydrolases 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730478|ref|YP_007076715.1|
Sequence length 263
Comment nicotinamidase-like amidase [Nostoc sp. PCC 7524]
Sequence
MNQSLRTLGVRPNAWMVNQAIADITRPQKNPQTVILPTETKTLRLDLAKSAILVIDMQND
FCHPDGWLAHIGVDVTPARKPIEPLNSLLPELRAVNVPVIWLNWGNRPDLLNISAGLRHV
YNPTGEGIGLGDPLPKNGAKVLMAGSWAAAVVDELPQLPEDIRVDKYRMSGFWDTALDSI
LRNLGITSLFFTGVNADQCVLTTLCDANFLGYDCILIKDCTATTSPDYCWLATLYNVKQC
FGFVTDSSAILTALNHPEATGGE
Download sequence
Identical sequences K9QUL7
WP_015139549.1.5551 gi|427730478|ref|YP_007076715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]