SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427730664|ref|YP_007076901.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427730664|ref|YP_007076901.1|
Domain Number 1 Region: 301-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-46
Family Ribonuclease PH domain 1-like 0.000007
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-43
Family Ribonuclease PH domain 1-like 0.0000263
Further Details:      
 
Domain Number 3 Region: 460-558
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-27
Family Ribonuclease PH domain 2-like 0.0000959
Further Details:      
 
Domain Number 4 Region: 143-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.07e-26
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 565-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 630-713
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.42e-17
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 
Domain Number 7 Region: 236-329
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000238
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427730664|ref|YP_007076901.1|
Sequence length 718
Comment polyribonucleotide nucleotidyltransferase [Nostoc sp. PCC 7524]
Sequence
MAEVDKSISFDGRDIRLKVGLLAPQAGGSVLIESGDTAVLVTATRSAAREGIDFLPLTVD
YEERLYAAGRIPGGIMRREGRPPEKAILTSRLIDRPLRPLFPSWLRDDLQVVAFTLSMDE
LVPPDVLAVTGASIATLIAKIPFNGPMAAVRVGLVGDDFIINPTYAEIEAGDLDLIVAGS
PHGVIMVEAGANQLPERDIIEAIDFGYEAVRDLIKAQQDLVAELGLEIVQEAPPAVDQTL
ANYIRDRASDEIKKILAQFDLGKTERDTALDAVKENIATAIADLPEDDPIRAAASADNKA
LGNTFKDITKHFMRRQIVEDNVRVDGRKLDEVRPVSCQVSVLPKRVHGSGLFNRGLTQVL
SACTLGTPGDAQNLNDDLQTDQSKRYLHHYNFPPFSVGETKPLRAPGRREIGHGALAERA
ILPVLPPKEQFPYVIRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPIIKPVSGAAMGLIK
EGDEVRVLTDIQGIEDFLGDMDFKVAGTDTGITALQMDMKISGLSLDVIAQAIHQAKSAR
LHILDKMLQTIDTPRTETSPYAPRLLTIKIDPEMIGLVIGPGGKTIKGITEETGAKIDIE
DDGTVTISAVDENKAKRARNIIQGMTRKLNEGDVYAGRVTRIIPIGAFVEFLPGKEGMIH
ISQLADYRVGKVEDEVAVGDEVIVKVREIDNKGRINLTRLGIHPDQAAAAREAAAVNR
Download sequence
Identical sequences K9QW35
WP_015139733.1.5551 gi|427730664|ref|YP_007076901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]