SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427731727|ref|YP_007077964.1| from Nostoc sp. PCC 7524

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427731727|ref|YP_007077964.1|
Domain Number 1 Region: 7-83,179-343
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.84e-47
Family Bacterial dinuclear zinc exopeptidases 0.005
Further Details:      
 
Domain Number 2 Region: 73-187
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.0000000000000029
Family Aminopeptidase/glucanase lid domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427731727|ref|YP_007077964.1|
Sequence length 347
Comment peptidase family protein [Nostoc sp. PCC 7524]
Sequence
MWTDDRLFEMITELVMHHSPSGAEAEINQFLMQQFASLGVAVWCDRADNIIAKIPGKISD
RAIAITAHKDEIGAIVKNIGDDGRVEVRKLGGAYPWVYGEGVVDLLGDHETISGILSFGS
RHVSHESPQKAQQEDTPVKWENAWIETKLTTAELEAVGIRPGTRMVIGKHRKHPIRLKDH
IASYTLDNKASVAILLALAQHLQQPAVDVYLVASAKEEVGAIGALFFTQNQSLDALIALE
ICPLSEEYPVKDGEIPVLLSQDAYGIYDEGLNGQLRQCAKQLDMPIQLATLSQFGSDASI
AMKFGHVGRAACLAFPTQNTHGYEIAHLGAIANCINLLKAFCETEFE
Download sequence
Identical sequences K9R022
gi|427731727|ref|YP_007077964.1| WP_015140777.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]