SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216340|ref|YP_007100805.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216340|ref|YP_007100805.1|
Domain Number 1 Region: 183-639
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.84e-112
Family Amylase, catalytic domain 0.00000000657
Further Details:      
 
Domain Number 2 Region: 647-749
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.16e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00013
Further Details:      
 
Domain Number 3 Region: 15-118
Classification Level Classification E-value
Superfamily E set domains 1.07e-16
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 4 Region: 141-197
Classification Level Classification E-value
Superfamily E set domains 0.000000000245
Family E-set domains of sugar-utilizing enzymes 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428216340|ref|YP_007100805.1|
Sequence length 801
Comment 1,4-alpha-glucan-branching protein [Pseudanabaena sp. PCC 7367]
Sequence
MNPTISSDQIDLLIWNLHQDPYYVLGPHQVEQDGKSVWAIRAYLPHAEMVTLVDPVRPGK
EYAMHSVHHPNFFECVIPEPELFRYQFKAHEHGKDRLLYDPYSFGVEVLTEFDRHLFAEG
NHYKIYEKLGAHIMEIDGIKGVYFAVWAPNARNVSVIGEFNYWDGRAHQMRKGDPGVWEI
FIPDLGEGAKYKFEVKNSEGHLYEKTDPHGYQQEIRPKTASIVADLEKYEWQDRNWMDER
RNSDPLVKPISIYEMHIGSWMHGNAEELPADGYPVVHAADMKPGARFLTYRELADKLIPY
VKDLGFTHLELLPVAEHPFDGSWGYQVIGFYAATSRYGTPQDFMYFVDKCHENGIGVIVD
WVPGHFPKDGHGLALFDGTHLYNPADDRIGEHKGWGTYAFNYERNEVKNFLIANALFWFD
KYHIDGIRVDAVASIIYRNYCREPGEWVPNEYGGCEYIAGVEFLKHLHGILYSYYPGILS
IAEESTAWPMVTAPTYMGGLGFNLKWNMGWMHDMLDYFEMDPWFRQFHQTNVTFSLMYAF
NENFVLALSHDEIVHEKSAMPGKMPGDIWQKLANLRCLYGYMFTHPGKKSLFMGMEFAQW
SEWNVWGDLEWWLLQHDKHIGMANLIRDLHRLLKQESALHTIDFSYEGFEWMECNDNKNS
VISFIRKGKDGEFVVVVCNFTPVLHGSYRIGVPEPGFYQELLNSDAADYWGSGAGNYGGK
PTDEIAMHSQRYSIDLCLPPLSTLVLKLDQESIEKNNAKREQERLEEERYHQEQERSKRL
LQEQEEQKQKAQDQLHPPILG
Download sequence
Identical sequences K9SCP0
gi|428216340|ref|YP_007100805.1| WP_015163351.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]