SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216373|ref|YP_007100838.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216373|ref|YP_007100838.1|
Domain Number 1 Region: 44-220
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000327
Family GAF domain 0.015
Further Details:      
 
Domain Number 2 Region: 239-415,442-456
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000191
Family PP2C-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428216373|ref|YP_007100838.1|
Sequence length 460
Comment protein serine/threonine phosphatase with GAF(s) sensor(s) [Pseudanabaena sp. PCC 7367]
Sequence
MSISLPPRRPSRSQEPRPETSSGKVVIKDLKDLITELTQEQTKIQELLSFLGFALRSYSN
LNQFLELIPLIATRVTDADGGALILFKSSGEMYLESLHCIDDPAVMRPQQVRSAIDRATQ
QASSGSAAALDDMISRFLGGDVKLFGTAIIVKNAVRGRLYVFSHKPNYAWGENRQKLMRL
VADQTAVGLENNALAAELLKKERQDRELEIGAEIQRQLLPRNCPAIAGVELAAKCLTANR
VGGDYYDFIPVKKGDRWSLVIADVMGKGVPAGLIMTMTRGMLRAEVLNGHSPGRILEHLN
QVMYDDLEKSNRFVTMFYSEYDPESRMLAYSNAAHTPALLWRSQTNTVHALDTLGSLIGL
EAGSKYEEAKIMLEPGDVVLYYTDGLTEAANQEGDRFDEENLRASMQYACEKAMSPSPQQ
DRSSTIRDHIFESVQKFIGNSHGHNDDMTLLVLCIKEISG
Download sequence
Identical sequences K9SE31
gi|428216373|ref|YP_007100838.1| WP_015163384.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]