SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216462|ref|YP_007100927.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216462|ref|YP_007100927.1|
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily CheY-like 5.41e-41
Family CheY-related 0.0006
Further Details:      
 
Domain Number 2 Region: 170-383
Classification Level Classification E-value
Superfamily PP2C-like 0.0000288
Family PP2C-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428216462|ref|YP_007100927.1|
Sequence length 384
Comment response regulator receiver modulated serine phosphatase [Pseudanabaena sp. PCC 7367]
Sequence
MSLILIIDDDPTMRLTLSRLLKKQGHSVATATDGEAGLIQVKEIQPSLIVCDWMMPGMDG
LEVCRRLKSDPELANTYFILLTAKDQIGDIVQGLESGADDFLSKPPNMNELRARVSAGLR
VYDATHALQVQKQLLEAELAEAAEYVRSLLPANLAGEIKAESCFLPSTQLGGDCFDIYWL
DDEHLVFYLLDVAGHGVGAALLSVSVLNLLRTRNLRKNAQLGSTDFRQPNEVLAALNNIF
QMSNHKDMYFTIWYGVYNRSTRLLNFASGGHPPAVLVDPNSSSKATRLRTSGLPIGMIND
IDFESATYKVAPNSRLFLFSDGAYEITMKEDIIWGIDSFIRTLVNSCPETDGSSLDGVLA
KIKQTNGHGSHFDDDLSLLEVRFD
Download sequence
Identical sequences K9SFD5
WP_015163473.1.5078 gi|428216462|ref|YP_007100927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]