SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216605|ref|YP_007101070.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216605|ref|YP_007101070.1|
Domain Number 1 Region: 171-449
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.98e-62
Family Alanine racemase-like, N-terminal domain 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|428216605|ref|YP_007101070.1|
Domain Number - Region: 556-664
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00136
Family Eukaryotic ODC-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428216605|ref|YP_007101070.1|
Sequence length 738
Comment arginine decarboxylase [Pseudanabaena sp. PCC 7367]
Sequence
MEQSAEQSRSTQTNLATENSAKPTHSDQMVEAIDPSLAQPSSSKVKELKAADTEVPEVPE
VPEGHLATSNRAIADQSAQSDQFDATLPTKSPSSVRMAKSIDSPTTNKWTIQDSEELYLI
NGWGEPYFSINEAGHVTVSPRGDRGGCIDLFDLVSDLRQRGLRLPLLLRFSDILADRIER
LNACFARAIARYNYQGVYRGVYPVKVNQQKHLVAELTKFGQPFQFGLEAGSKPELLIAIA
TLKTPGALLICNGYKDREYVETAMLSQRLGKKPIIVLEQLEEVDLAIAAAQKLGIKPNLG
VRAKLSSKGSGRWAESAGDRAKFGLHMWEILTVVEKLAAADLLDSLQLLHFHIGSQISAI
STIKDALREAAQIYVQLAKIGANMQYIDVGGGLAVDYDGTKTNSAASKNYNMQNYAYDVV
AEIKEACAEGKVEPPTIVSESGRAIASHQSILIFDVLGTSSRPQAGIEPLQPGEHLIIRN
LFETLENINAQNYQEAYHDAIQFKGEAASLFGFGYLGLRERARVERLYWECCDRILKIVR
QQEHVPDELSDLEISMAQTYYCNLSVFQSIPDNWAIGQMFPIMPIHRLNQEPSNRGTIAD
LTCDSDGHIKEFIARYSSKEILELHPFDKNDNDPYILGLFLGGAYQEILGDLHNLFGDTD
TVHIHITHRGYKVEHVVKGDTMNEVLEYVQYSRGELLESMRRETEAALQEDAITIDEARL
LLQNFEHSLDGYTYLSPT
Download sequence
Identical sequences K9SDE1
gi|428216605|ref|YP_007101070.1| WP_015163616.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]