SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216627|ref|YP_007101092.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216627|ref|YP_007101092.1|
Domain Number 1 Region: 27-374,408-426
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.11e-105
Family B12-dependent (class II) ribonucleotide reductase 0.00014
Further Details:      
 
Domain Number 2 Region: 792-1145
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.58e-102
Family B12-dependent (class II) ribonucleotide reductase 0.00089
Further Details:      
 
Domain Number 3 Region: 424-549,715-794
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 7.46e-39
Family Intein (protein splicing domain) 0.013
Further Details:      
 
Domain Number 4 Region: 633-748
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000489
Family Intein endonuclease 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428216627|ref|YP_007101092.1|
Sequence length 1153
Comment ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent [Pseudanabaena sp. PCC 7367]
Sequence
MVQEIDRTKANAQANLSKSDNTKANTSNAFPEDAPVANPVFFRTYSRKIGDRRESWQQVC
DRTISSLKQLGNLNDEEVALISRMQRQLKALSSGRWLWVGGTDWIAQPSNFSGGYNCTST
NVVDWRAFGLMMDLAMMGCGTGAVLEEKYISQLPVICNRLNVSLAGEVGSTPAQARRETT
EVEVNGDRVTIYVGDSRHGWVKSYQTILELSSDDRFSGEVQVTVDLSDVRASGEQLKGFG
GVANPVKLPSLYNRCARVLNKAIGRKLTSVECCILIDEAAVCIVAGNIRRSAGMRQGASD
DELFAGAKLNLWQQDESGNWRIDPERDALRMANHTRVYHHKPTEQECVDAVRQQYYSGEG
AIQWAGEAIARSNVDILATPELRKEFMQVYSQGLENAKAWLRSHYPDMPETELEHRLERY
GLNPCVTAETWVHTGNGARQVKDLVGVQHSTYVNGELFSTTPEGFFFTGVKPVVKLTTKE
GYTLRLTGNHQLLKVTAQTQKQQYSQWVEAGALNQGDRILIHNHRDLQPWHGMGTFAEGW
LLGNLIGDGCFSSHAASYSHQAKLRYWGDTQAEMNEYALDLVKSNVATAPNLAGIYHQQN
KYDEIGSAGLAKLANQYGITQSHKTLTPGVEQSSYEFYQGFLRGLFDADGSVQGSQAKGV
SIRLAQSNLPLLEAVQRMLLRVGIASTIYQNRRPAGFRQLPDSNRKLAEYFCQAQHELVI
ANDNIPVFQDVIGFQDATKAERLQQVLSGYKRNFNRERFAVTIASIEADGEAAVFDCTVP
GPARFDANGITAHNCGEIIGSNFHCNLSEIHLNQLDPNNEQDQADAFAAGALSVATLLNH
QFTEDRYQESRQLDPIVGVSFTGLFDFFVNAFGVEWLQWWAEGRPATMPGIEFKEKESAY
LRKWSDTVHRVVWDYCDRHGIKRPNRCTTVQPSGTKSLLTGASPGWHPPKAQRFIRRVTF
RKNDPVAMACIDYGYNVVPSQSDKDENGNLLNDPFDPRCTEWLVEIPVRVPWADLPGADT
IDISKFSALAQMDFWMNVQQSYTRHNTSSTIELREPEIEAVGKRIYEAIERDQGYISTAL
LARFDDLQTFPRLPFEPIDREKYEQELAAVLKRRGTDDFHTALSLYDSGFLVEAGPAGCD
SDKCMLPEEQPKA
Download sequence
Identical sequences K9SFV0
gi|428216627|ref|YP_007101092.1| WP_015163638.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]