SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216659|ref|YP_007101124.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216659|ref|YP_007101124.1|
Domain Number 1 Region: 206-269
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000425
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|428216659|ref|YP_007101124.1|
Domain Number - Region: 281-362
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000536
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 122-204
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00157
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428216659|ref|YP_007101124.1|
Sequence length 374
Comment mechanosensitive ion channel protein MscS [Pseudanabaena sp. PCC 7367]
Sequence
MFNLFTPANNFLSNFHNLVSSTTSWGGKLFAHLNLPHLDLEQWHDAWLEVSTNISANISA
SIWLNASPYLGFLLAQQDSSNSQNGNVSVGDTIDKAANSSNSADSGQQASEIFAEITFGK
ILQAIIIMATAYGTVWLINRLINWLSEKVPLRFRLSVKQSIPFWKAFLFGLAAALLINLF
LNLSPNNVLAITGTAAVAIGFAFKDYASSLIAGIIALFEGPYQVGDRVKIDDYYGEIVSY
GLRGIKIQTPDDNIVTIPHNKIWTEAIANSNKGSLEAQVIADFYFAHATDVEMIIDILYQ
VAYTSKYTQLTLPILVVMDEKPFATHFKLKCYPIDARDEFIYKTDLLKRAKQAFIRHDIN
YPIVLTQPQPNQSG
Download sequence
Identical sequences K9SFD2
gi|428216659|ref|YP_007101124.1| WP_015163670.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]