SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428216696|ref|YP_007101161.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216696|ref|YP_007101161.1|
Domain Number 1 Region: 6-235
Classification Level Classification E-value
Superfamily Ribosomal protein S2 3.14e-93
Family Ribosomal protein S2 0.000000477
Further Details:      
 
Weak hits

Sequence:  gi|428216696|ref|YP_007101161.1|
Domain Number - Region: 241-295
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0471
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428216696|ref|YP_007101161.1|
Sequence length 306
Comment 30S ribosomal protein S2 [Pseudanabaena sp. PCC 7367]
Sequence
MPVVSLAELLESGVHFGHQTRRWNPKMDSYIFTERNGVHIIDLVQTAQCMEQAYQYMRQA
SEQGKKVLFVGTKRQAAGIIAQEAARCGGHYVNQRWLGGMLTNWTTIKTRIERLKDLLRR
EESGAMDRMPKKEAARARRELDKLQKYLGGLKSMRKPPDIVVIVDQKREYNAVQECQKLK
IPIVSLLDTNCDPDTADIPIPANDDAIRSVKLIISRLADAIYEGKHGQIDEVDYDSAGNP
EDFVDEAYVETVAAEETVTAAEAVATAVEETATVAEEAATTATAVQETATAVEEAAAASK
SGGEEE
Download sequence
Identical sequences K9SEW3
gi|428216696|ref|YP_007101161.1| WP_015163707.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]